KEGG   Coccidioides immitis: CIMG_01614Help
Entry
CIMG_01614        CDS       T01114                                 

Definition
(RefSeq) glutathione transferase
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 4567262
NCBI-ProteinID: XP_001247843
UniProt: A0A0E1S0G4
LinkDB All DBs
AA seq 735 aa AA seqDB search
MDDAGTETPTNPPQLPPPQPSPELGALPRTPLNEHGLSLDRDLEAEIKNGGTHNQGQLPG
DSEEPRVQEGPGQEHAGLKDGQAWDQIMVDAVPTTDAIATAAIVTEQAQTEPAHAAIVVD
PEISTPEAQNHGSSIGQSSIQRQPRQSQTSVAPDSNSVLAVTAPQYTFLESRQAATPQHL
GQPPPIPPPSPNYGLPAHPEFIQPRSNHGHPMSLPPCPPSGAPPIQQQQQPTLQNIICHF
PSPIQSSPAAPGLSNDGASHFKNMKLIPEPPDLQRWRERLFNVEGTIVLSEEEFQTYFPH
VDNVYSHRSTQRYKRKPFISHYWDCRLKGRPPGTPKSADPNKKKRKRIARERNLCDVKIK
ITEYFPGAMTMAPDLDMGISALAGAVDSLPATSGVNAPTASQPFGVLAPSTMLPEGHPGA
TGARYYTIQRVNGNGANGRSVTAGGSHRHTLEESDRIKKNSVQRFLIKDEKEKKKAISQQ
LKTYHKKASGYAWLTVNKHKRESDLKLYASCFCPFVQRVWIALEVKGIPYQYIEVDPYRK
PDSLLEVNPRGLVPAIRHGNWACHESTVLLEYLDDLDAGNPLLPPGKPQLRAHCRLWADH
VNRHIIPCFYRLLQEQDFQKQIEYTEELKDDISKLVNASHVTGPFFLGPDISFVDIQFAP
WMLRLSRVLKPYRGWPDPEKGSRWAAWVDAIEANDQIMATTSSDELYLDSYQRYAENRPD
TSMLANAINSGRPLP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcagggacggaaacaccgacaaatccaccccaattgccaccaccacaacca
tcgccagaacttggagccttacctagaactcccctgaacgagcacggattgagcttggat
cgcgacctagaggccgagattaaaaatggtggtacacataatcaagggcagttgcccggg
gactctgaagagcccagggtgcaagagggccctggccaggagcacgctggcttgaaggac
gggcaagcatgggatcaaataatggtcgatgctgtacctaccactgacgcaattgcgacc
gccgccatcgtcactgaacaagctcaaaccgagccggcgcacgctgccattgttgtcgac
ccagaaatctcgacccctgaggcgcagaatcatggtagcagcattggccaatcctcaatt
caaaggcaaccgcgtcaaagccagaccagcgtggctcctgacagtaattccgtcctagcg
gttaccgcaccgcagtatacttttctagagagtcgccaggcggctactcctcagcatctt
ggtcaaccaccccctattccaccgccttcaccaaattatgggcttccagcgcatccagaa
ttcatccagccacgtagtaaccacggccacccgatgtcacttcctccctgccctccatcg
ggcgcgccgccgatccaacaacagcaacagccgactcttcaaaacataatatgccacttt
cccagtcctatccaatcgagccctgcagcaccggggttaagcaatgacggtgcaagtcat
tttaagaatatgaaactcattcctgagccgccagatctacagcgttggagagaaagactg
ttcaatgttgagggtactatcgtcctgagtgaggaggaatttcagacctattttccacat
gtcgacaacgtctactcccaccgctctactcagcgctacaaacgcaaaccttttatatcc
cattactgggactgtcgactgaaaggtcgcccgccgggaacccccaaatctgccgaccca
aacaaaaagaagcgcaaacgtatcgcgcgcgagaggaatctatgcgacgttaaaataaaa
atcacagagtacttcccgggagctatgaccatggccccggatctggacatggggatctcg
gcgctcgccggcgctgttgactcattacctgcaacgtccggagtcaatgcgccgacggct
tcccaaccgtttggcgtgttggcaccgagtacgatgctacccgagggccatccgggcgca
acaggagcgagatattacacaattcaacgagtaaatgggaacggggccaatggcaggtcc
gtcacggccggtggatcgcatagacatactctggaagaaagcgatcggatcaagaagaac
agtgtgcagcggtttctgataaaggacgagaaggaaaagaaaaaggccatcagccaacag
ctcaaaacgtaccacaaaaaggcgtccggctacgcttggctaacggtgaacaaacataaa
cgagagagcgatctcaagctttacgccagttgcttttgccctttcgtccagcgggtttgg
attgcacttgaagttaagggaataccgtatcaatacatcgaagttgacccctatagaaag
ccggattcgctgttggaggtcaatccgcgggggttagttccggctatacgtcacggcaac
tgggcttgtcacgaaagtaccgttttgttggaatatctcgacgatctcgatgccgggaat
cctctcttgcctcccggaaaaccacaacttcgggcgcattgccgattgtgggcagaccat
gtaaaccggcatatcataccctgtttctatcgtcttctccaagagcaagatttccagaaa
cagatcgagtatacggaagagttaaaggacgatattagcaaactcgtcaacgcgtcccat
gtaacgggaccgttcttccttgggccagacatctcctttgtcgacattcaatttgcaccc
tggatgcttaggctgagtcgcgtattaaagccatatcgtgggtggccagatccagagaaa
ggcagtcgctgggctgcgtgggtggatgccatagaagccaatgaccagatcatggccaca
acgagttcagatgaactatacttggatagctatcagagatatgccgaaaatcgacccgac
acatcgatgctggcgaacgccattaattccggaagacctctgccgtaa

DBGET integrated database retrieval system