KEGG   Coccidioides immitis: CIMG_02339Help
Entry
CIMG_02339        CDS       T01114                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cim  Coccidioides immitis
Pathway
cim00020  Citrate cycle (TCA cycle)
cim00190  Oxidative phosphorylation
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01200  Carbon metabolism
Module
cim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cim_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIMG_02339
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CIMG_02339
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CIMG_02339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4566571
NCBI-ProteinID: XP_001248568
UniProt: J3KL57
LinkDB All DBs
AA seq 647 aa AA seqDB search
MSFNGLRSLAPATRFSRSLRDQRRLFSSSRPAARIITSQPLRAKEASPFLTKKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLMENGECKGILAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEV
LTIDEKGNDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNATPNTP
HKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDANWMKHTLTFQKEPHGKVDLTYRAVTQTTLDESECKPVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaacggcctgcggagccttgctcccgctacaagattctccagatctttgaga
gatcaaaggcgacttttctcatctagcagacctgcagctcgaatcattaccagccaaccc
cttcgtgcgaaagaagcctcgccatttctcacaaaaaaatacccagtgatcgatcatgag
tacgatgccgttgtcgtcggtgccggaggtgccgggttgcgagcagctttcggtttggcc
gaagctggattcaatactgcttgtgtcacaaaactctttcccacaagaagtcacacagtc
gctgcccagggtggtatcaacgccgccctcggaaatatgcacgaggatgactggagatgg
catatgtacgataccgtgaaaggttccgattggctcggtgaccaggatgctattcactac
atgaccagagaagctcctcagagtgttatcgaacttgagggctacggctgccctttctct
cgaaccgaggatggcaagatctaccagcgagctttcggtggccagtcgaaggaatttggc
aagggaggccaagcgtaccgatgctgtgctgccgccgacagaactggccacgctcttctc
cacaccctctacggccaatctctccggtacaacgctagctatttcattgaatacttcgcc
cttgacctcttgatggagaacggcgagtgcaaaggtatcctcgcatataaccaggaggat
ggaacacttcaccgcttcaaggcccatcataccgtcttagccactggcggttatggacgt
gcctacttcagctgcacttccgcccacacttgcactggtgatggtatggccatggtggct
cgtgctggattgcctaaccaagatctcgagttcgtgcaattccatccaactggtatctat
ggtgccggttgtctcatcaccgaaggagctcgtggtgagggtggctatctcctcaactct
aatggtgaacgtttcatggaacgttacgcatccactgccaaggaccttgccagtcgagat
gtcgtttctcgttctatgacccttgaaatccgtgagggacgtggtgttggccctgagaaa
gatcacatctacctccaacttagccatcttcctcccgaaatcttgcacgagcgcctccct
ggtatttcagaaactgcttccatcttcgctggcgtcgatgtcaccaagcaaccaatccca
gtcctgccaaccgttcactacaacatgggtggtattcctactcgctacactggtgaagtg
ctcaccattgatgagaagggcaatgacaagatcgttcctggtctctatgcttgtggtgaa
gccgcctgtgtctctgtccatggtgctaaccgtcttggtgccaactctctcctcgacctt
atcgttttcggccgtgctgtttcccacacgattcgcgacaatgctactccaaacactcct
cacaaggaaatcagtgccgatgccggtgctgagtctatcgaagtgcttgataagatcaga
actgctgatggaccaaagtccactttcgacatcagaaacgctatgcagaagactatgcag
acagatgttagcgttttccgtactcaagagagtttggacgagggtgttcgcaagattaac
gaagttgaccaaatgttcgcgcaagttggaactaaggatcgcagcatgatctggaactcc
gacctcgtggagacccttgagttgagaaacttattgacttgcgctactcaaacagccgtt
gctgctgctaaccgcaaagaatcgcgtggcgcccacgcccgcgaggattaccccgaccgt
gacgacgccaactggatgaagcataccctcacattccagaaggaaccccatggaaaggtc
gatcttacttaccgcgctgtgacacagaccacgctggacgagagcgagtgcaagcctgtc
ccaccattcaagcgcgtatactag

DBGET integrated database retrieval system