KEGG   Coccidioides immitis: CIMG_02455Help
Entry
CIMG_02455        CDS       T01114                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cim  Coccidioides immitis
Pathway
cim00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIMG_02455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cim02000]
    CIMG_02455
Enzymes [BR:cim01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CIMG_02455
Transporters [BR:cim02000]
 Other Transporters
  Pores ion channels [TC:1]
   CIMG_02455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_5 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 4566159
NCBI-ProteinID: XP_001248684
UniProt: J3KLF1
LinkDB All DBs
AA seq 260 aa AA seqDB search
MAVTLGPSSPDADIHPIATGPAKEVVEKHSSEQPFKFYAGWFCPFVQKTWIVLEEKQIPY
QYIEVNASLDPSSLLSLNPRGPIPTLYCPQPNGSKPLYESNIINEYLDDVFSSHQPHLFP
LDPYKKARAKTWVDFVTSRIIPSFNRFLQAQGEGEIAKAHNEFLGHLKEFIDAMDSSGPY
FFGEDFTMPDVALAPWAMRLWLLDHLKGGLRIPEPGEGGEDEQVWERWREWVDAVGSRNS
VANTLSEKEYYLPIYKKVCR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaccctggggccttccagcccggacgcagacatccatcccatcgcaacgggt
cctgcaaaggaggttgtagaaaagcactccagtgagcagccattcaagttttatgctggc
tggttttgcccgttcgtccagaaaacctggatcgttctcgaggagaaacagattccttac
caatacatcgaagtcaatgcgtccctcgatccgagttctctcctgtcactaaatccgcgt
gggccgatccccacgctttactgtccccagccaaacggctccaaaccgctctatgaatcg
aacatcatcaacgaatacctcgacgatgtcttctcgtctcatcagccacacctcttcccg
cttgatccgtacaagaaggccagggccaagacctgggtggactttgtgacgtcgcggatc
ataccctctttcaatcgcttcttgcaggcccagggcgaaggagagatcgccaaggcccac
aacgagtttctaggccacctgaaagagttcatagacgcgatggacagtagcgggccgtac
ttcttcggtgaagatttcaccatgcccgatgttgcacttgctccgtgggcgatgagactc
tggctactcgaccatctcaagggtggcctgaggattccagaaccaggtgaaggcggcgaa
gacgagcaggtttgggagaggtggagggagtgggtggatgcagttggcagcagaaactct
gtagccaatacactcagcgagaaagagtattatttgccgatatacaaaaaggtatgccga
taa

DBGET integrated database retrieval system