KEGG   Coccidioides immitis: CIMG_03804Help
Entry
CIMG_03804        CDS       T01114                                 

Definition
(RefSeq) DNA ligase I, ATP-dependent (dnl1)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cim  Coccidioides immitis
Pathway
cim03030  DNA replication
cim03410  Base excision repair
cim03420  Nucleotide excision repair
cim03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CIMG_03804
   03410 Base excision repair
    CIMG_03804
   03420 Nucleotide excision repair
    CIMG_03804
   03430 Mismatch repair
    CIMG_03804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cim03032]
    CIMG_03804
   03400 DNA repair and recombination proteins [BR:cim03400]
    CIMG_03804
Enzymes [BR:cim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CIMG_03804
    6.5.1.6  DNA ligase (ATP or NAD+)
     CIMG_03804
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CIMG_03804
DNA replication proteins [BR:cim03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CIMG_03804
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CIMG_03804
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CIMG_03804
   NER (nucleotide excision repair)
    Other NER factors
     CIMG_03804
   MMR (mismatch exicision repair)
    Other MMR factors
     CIMG_03804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C NuDC
Motif
Other DBs
NCBI-GeneID: 4562844
NCBI-ProteinID: XP_001244363
UniProt: J3KC51
LinkDB All DBs
AA seq 831 aa AA seqDB search
MSNPVRKRKRGDPGDPPRTFRSIDSFFKSPRKQPHEADCRIPKSPSEHQLLTDEELARKL
QAEWDNDASSNFRNATPTNSDENQAPPSQDMKASDGQDPIPAPPKSCVFASSKKKKSVLS
LQTSTSAEDTISMSLPLDQPPLTFSPSLYLDKLREFWNTEGGHASYSILARAFSLVNSTQ
SRIRIVDILVNLLRILIEGDPDSLLPAVWLATNAFAPPYVPLELGLGGSAISKALKKAYG
LDNLGLKTLYDKYGDAGDVAYEAKKKQSFTLRRPKPLSIKGVYDSLMKIANSKGTGSQEN
KQRLVEQLLRDARGAEESRYIVRTLVQHLRIGAVRTTMLIALARAFLYSRPPSASYRVHT
NADLMKLKRDELASLYAKAEEMIKASYARHPNYNDLIPCLLATGISEAVLAKCGLALHVP
LLPMLGSITRDLTEMLTKLQGRKFSCEYKYDGQRAQVHCDSSGKVSLFSRHLELMTDKYP
DLVSLVPQIRGDGVSSFILEGEVVAVDQESGVLLPFQTLSNRAKKNVEIGDIKINVCLFA
FDLMYLNGEALLERPFRERRELLRSLFVEIPNRFSWVKSIDATSSESETILNFFQEATNA
KCEGIMVKVLDDGTDGEASGILTSEESSNISGEKQKASRRRTLLSTYEPDKRLDSWLKVK
KDYNAAFDTLDLIPIAGWHGQGRKAQWWSPILLAVRNPETGSLEAVTKCMSGFTDKFYQE
NKEKYAENGNNTIPRPSYVEYRNEPEVWFEPQEVWEIAFADITLSPTYTAAIGMASEERG
LSLRFPRFLRVREDKTIEEASTSSTLAELWKKQMARLQSEGADLPQEEENG
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatcccgtcagaaaacgcaaaagaggcgatcctggtgacccgccgaggacattt
aggagtattgactcctttttcaaaagcccgagaaagcaaccacacgaagccgactgtcgc
ataccaaaaagcccttcggaacaccaattactgacagacgaagagcttgctcgaaagctg
caagcagaatgggataatgatgcttcttcgaatttccgaaatgccacgcccacaaattcg
gacgaaaaccaggcgccgccgtctcaagacatgaaggccagcgacggccaggaccccatc
cccgcgcctcctaagtcatgtgtattcgcttcttccaaaaaaaagaaaagtgttttgtcc
ctccaaacctccacatccgcggaagacacaatatctatgtcgttaccgctcgatcagcca
cctctaacatttagcccgtctctctacctcgacaaacttagggaattctggaataccgag
gggggccatgcttcctattcgatattggccagggcgttctctctagtcaacagcacacaa
agcaggattaggattgtggatatcttggttaatttattgagaattttaatcgaaggggat
ccggatagtctgctcccagcggtctggcttgctacaaacgcgttcgcaccaccgtatgtt
ccgcttgaattaggattgggaggatctgccatctcaaaggcattgaagaaggcttatgga
ttggataacctgggtctaaaaactctttatgacaaatatggagatgccggtgatgtcgcc
tatgaagctaaaaagaagcaatcctttacgttaagacgaccaaagccgctctccatcaaa
ggtgtttatgattcgctaatgaaaatcgctaacagtaaagggacgggtagccaggaaaac
aaacagaggcttgtggaacagttacttcgagacgcgagaggagctgaagaaagtcgatat
attgttcgaaccctcgtccagcacttgcgcatcggagctgtcagaaccaccatgcttatt
gcattggctcgtgccttcctctattcaaggcctccgtcggctagttatagggttcatacc
aatgctgatcttatgaagcttaagagggatgaacttgccagtttatatgcaaaagcagag
gaaatgattaaagctagctacgctcgtcacccaaattataatgacctgataccatgcctt
ttagcaacgggtatctcggaggctgtcctcgctaaatgtggcttggcacttcatgttccc
ttgttgccaatgctaggaagcatcacgcgtgacttgacagagatgcttaccaaacttcaa
ggcagaaaattcagctgtgaatacaaatatgacggccagcgcgcgcaagtgcattgcgat
tcatcgggaaaagtttcgcttttctcccgccacttggagctgatgacggataaatatccg
gatctagtatctctcgttccgcagattcggggagacggtgtgtccagcttcatccttgaa
ggggaagtggtcgccgtggaccaagaatctggggttttgttgcccttccagacgctttct
aatcgggcgaagaaaaacgttgagataggggacatcaaaattaatgtttgtctttttgca
ttcgatcttatgtatttgaacggagaagcgttgttagaaagaccttttagagaaagacgt
gaactcttgcgaagtctttttgtggagatacccaaccggttttcctgggtgaaaagcatt
gatgcaacgtcttccgagtcggaaacgattctcaattttttccaggaagccacaaacgca
aaatgcgaaggtattatggtgaaggtcttggatgatggtaccgatggcgaagcatccggc
atcctcaccagcgaagagtcgtccaatatttccggcgagaaacagaaagcctcacgaagg
cgcactttgctctctacttatgagcctgataaacgactcgattcgtggctcaaggtgaag
aaagactataatgcagccttcgatactctggacttaattcccattgccggttggcatggc
cagggacgaaaggcccaatggtggtcaccaattctccttgcagttcgaaatccggaaact
ggctcactggaagctgtcaccaagtgcatgtctggttttactgacaaattctatcaagag
aacaaagagaagtacgccgagaatggcaacaatactatcccaaggccaagctacgtggag
tataggaatgagcccgaggtatggtttgaacctcaggaggtttgggaaattgcttttgca
gatatcacacttagcccaacgtacacggcagccatcgggatggccagcgaggaacgtggg
ttaagcctgaggtttccaagattcctcagggttcgtgaagataaaaccattgaagaagca
agcacttctagcacccttgctgagctctggaagaaacaaatggcgcgactgcaaagcgaa
ggtgctgatttgccgcaggaagaagaaaacggatga

DBGET integrated database retrieval system