KEGG   Coccidioides immitis: CIMG_04563Help
Entry
CIMG_04563        CDS       T01114                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cim  Coccidioides immitis
Pathway
cim00730  Thiamine metabolism
cim00790  Folate biosynthesis
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CIMG_04563
   00790 Folate biosynthesis
    CIMG_04563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cim04147]
    CIMG_04563
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cim00537]
    CIMG_04563
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CIMG_04563
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_04563
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cim00537]
 Enzymes
  CIMG_04563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 4562646
NCBI-ProteinID: XP_001245122
UniProt: J3KDS2
LinkDB All DBs
AA seq 606 aa AA seqDB search
MSRNDPLLVPSDHSPERSDAEEDALLTGQRTHRSERGRGPSFWREVGLFSWALIATAAVI
ILAVVYQHQQSTGRHEGSLAPGDKPAGKRNLIFMVSDGMGPTSLSMTRSFRQSRDGLPID
DILVLDKHHIGQSRTRSSSSLITDSAAGATAFSCAKKSYNGAISVLPDHSPCGTVLEAAK
AAGYMTGLVVTTRITDATPACFSSHANMRSYEDLIAEHQIGEYPLGRQVDLIIGGGRCHF
LPNTTSGSCRGDARDIVQLAKSKGFSYIDDREGFDGLKMGSAAQLPLLGLIAEKNVPFEI
DRRFQNDIYPSLEEMTRTALKALSDATRDSDKGFFIMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFAAVLEFLEKDSTPGVLVSTSDHETGGLSAARQLHESYPDYKWFPGVLENATHSS
EYLETKLYNYLDDEGKSVPKEEQRAYVRRQFVEKGLGIFDAKNSEIDQLLQAGDPVPAAY
VFADMISRRAQIGWSTHGHSAADVNIYASSPEDALDLVGNHENTEVGDFLAKYLDLDLDA
ITQKLKETQTSPKAATYDYAWMGEPLADDVVVDELDTYHGDFKKRSLSGRSVNYIGGGGC
GCGAVH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaacgatcccttgctagtaccctccgaccactcgccggaacgaagcgatgcc
gaagaagatgccctcctcaccggtcagcggactcatcgaagcgagcgcggccgtggtcca
tcattctggcgtgaagttggattgttctcctgggctttaatagccactgcagccgttatc
atcctcgcagtcgtgtaccagcatcagcagtcgaccggtagacatgaaggaagcttggcc
cccggcgataagccggcaggaaaacggaatcttattttcatggtttctgatggaatgggc
cctacgagtttgtcgatgacacggagcttccggcaatcgcgggatggccttcccatcgac
gatattctcgttttggataagcatcatatcggacagtctcgaacaagatcatcgtctagc
ttgattacggactctgcggcgggcgcgacggcattttcttgtgcgaagaagagttataac
ggtgctatctctgtgctgcccgaccatagcccatgcgggaccgtcctagaggcagcgaag
gcggctgggtatatgacagggttggtggttacaacgagaattacagatgccacccccgcc
tgcttttcttcccatgccaacatgcgctcgtatgaggacttgattgcagagcaccaaatc
ggagaatacccgctgggacgccaggttgatcttatcattgggggaggcagatgccatttc
cttccaaacactacttctggcagctgtcgtggtgacgccagagatattgtgcagcttgcc
aaatctaaaggtttttcatatattgatgaccgtgaagggttcgatggacttaaaatgggc
agtgcggcccagcttccattacttggccttatcgcggaaaagaatgtgccattcgaaatt
gaccgtcgatttcaaaacgacatatatccttctctggaagaaatgactcgcacggccttg
aaagccttaagcgatgccacacgcgatagcgacaagggcttctttattatgattgaaggt
tcgcgtattgaccatgctggccatggcaatgatcctgccgcccaggtccatgaagtccta
gcttatgatagagcttttgctgctgtcctggaattccttgaaaaagactctacccccggt
gtgcttgttagcacatcggatcacgagaccggaggtctatcggcggcccggcagcttcat
gagtcgtatcctgactacaaatggttcccaggtgtccttgagaatgccacacattcctct
gagtacttagagaccaagctctataactaccttgatgacgaaggaaaatccgtgcccaag
gaggagcagcgtgcgtacgtacgtcgacaattcgtggagaagggacttggaatatttgat
gcgaaaaattccgaaatcgaccaactcctccaggccggcgacccggtgccggccgcgtat
gttttcgctgacatgatcagccgaagagcccagataggatggtcaactcatggacattcc
gctgcggatgtgaatatctacgcctcttccccagaagacgccttggatcttgtcggtaat
cacgaaaacaccgaagttggcgacttcttagctaaatatctcgacttggatcttgatgca
atcacccaaaaactcaaggagactcaaactagtccaaaagctgccacctacgattacgcc
tggatgggcgaaccattagctgatgatgtcgtcgtcgatgaactcgatacctaccatggc
gacttcaagaaacgtagtctctctgggagaagcgtcaattatatcggcggtggaggatgt
ggttgcggagcggtgcattga

DBGET integrated database retrieval system