KEGG   Coccidioides immitis: CIMG_06474Help
Entry
CIMG_06474        CDS       T01114                                 

Definition
(RefSeq) fatty acid elongase
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
cim  Coccidioides immitis
Pathway
cim00062  Fatty acid elongation
cim01040  Biosynthesis of unsaturated fatty acids
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01212  Fatty acid metabolism
Module
cim_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    CIMG_06474
   01040 Biosynthesis of unsaturated fatty acids
    CIMG_06474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cim01004]
    CIMG_06474
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     CIMG_06474
Lipid biosynthesis proteins [BR:cim01004]
 Elongase
  LCFA
   CIMG_06474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 4561139
NCBI-ProteinID: XP_001242578
UniProt: A0A0E1RW07
LinkDB All DBs
AA seq 354 aa AA seqDB search
MSLELLQQFPRPTLDRPFGVELWPIFDKAFSAVAGYSATDFKFVQGETPMSTLKMTATAL
ISYYVIIFGGRELMRNRPAMKLNGLFMIHNLYLTLASGILLALFIEQLLPTLWRHGVFYA
ICDHRGGWTKQLVILYFLNYITKYIELVDTVFLVLKKKPLTFLHTYHHGATALLCYTQLI
GLTAVSWVPITLNLMVHVVMYWYYFQSARGVRVWWKQWITRLQIAQFVIDLGFVYFASYT
YFASTYFPHFPNAGKCAGEEFAAFSGLIILSSYLVLFISFYFATYKKTGKGGRPRRNTGK
QAAIAMKNLEVPPVGLQPKTNGVSNGNANGSIATNGTAVSSARANGPVTRSRKA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgagctcctccagcaattccctcgacctaccctcgaccgtccgttcggcgtc
gagttatggcccattttcgacaaggccttctcggccgtggccgggtactctgccaccgac
ttcaagttcgttcaaggcgagacgcccatgtcgactctcaaaatgacagcaaccgccctg
atatcatactatgtcatcatcttcgggggccgcgagttgatgcgcaatcgtccagcgatg
aagttgaacgggctgtttatgatccacaatctatatttgacacttgctagtgggatattg
ttggcgctgtttatcgaacagcttctgcccacgctctggagacatggggtcttttatgcg
atttgcgatcaccgtggaggatggacaaagcagctggtgattctttacttcttgaattat
atcaccaaatatattgagctcgtggacacagtattccttgtcctgaagaagaagccactc
acatttctccacacctatcaccatggtgccactgctctcctttgctatactcagctaatt
ggtttgaccgctgtttcatgggtcccaatcacactcaacctgatggttcatgttgtcatg
tactggtactatttccagagtgctcgtggtgtgcgtgtctggtggaaacaatggattact
cgcctccagattgctcagtttgttattgatcttgggtttgtctactttgcatcctacacg
tactttgcttcgacctacttcccccatttccccaatgcgggcaaatgtgcgggtgaagag
tttgccgccttctctggcttgataatcctcagctcttacctcgttctctttatctcgttc
tacttcgctacatacaagaaaactggaaaaggcgggcgcccacgacgaaacaccggcaag
caagcagcaattgcgatgaagaacctggaggtccccccggttgggctgcaaccgaagacc
aatggtgttagcaacggcaatgccaatggcagcatcgcaacaaatgggacagctgtctcc
tctgctagagccaatggcccagtcacacgctcacgaaaagcttaa

DBGET integrated database retrieval system