KEGG   Coccidioides immitis: CIMG_07673Help
Entry
CIMG_07673        CDS       T01114                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cim  Coccidioides immitis
Pathway
cim00020  Citrate cycle (TCA cycle)
cim00480  Glutathione metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01200  Carbon metabolism
cim01210  2-Oxocarboxylic acid metabolism
cim01230  Biosynthesis of amino acids
cim04146  Peroxisome
Module
cim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cim_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIMG_07673
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIMG_07673
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CIMG_07673
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CIMG_07673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh DUF971
Motif
Other DBs
NCBI-GeneID: 4559702
NCBI-ProteinID: XP_001240510
UniProt: J3K3W0
LinkDB All DBs
AA seq 509 aa AA seqDB search
MPALRASSVPSRLSLTRLARNNSQPAPRLLSTFSIRPAPPLPLNSSTARSCLPSTSSIHN
TSAATTRFQSSFAPLRAVSWTAASSPSLSHTQKRNMSTGRKKIKVKNPVVELDGDEMTRI
IWQDIKDKFIYPYLDVDLKYYDLGLEYRDQTDDKVTVDAAEAIKKYGVGVKCATITPDEA
RVEEFKLKKMWLSPNGTIRNILGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAFGDQYRA
TDRLVPGPGKLELVYTPTNGEPERITVYDFQGAGIAQVQYNTDDSIRGFAHASFKLALLK
GLPMYMSTKNTILKKYDGRFKDIFEEVYEAEYKKAFEAKGIWYEHRLIDDMVAQMIKGDG
GCVIAMKNYDGDVQSDIVAQGFGSLGLMTSTLTTPDGSAFESEAAHGTVTRHYREHQKGR
ETSTNPIASIFAWTRGLIRRGQLDETPDVVTFAEQLERACIEVVDEEGIMTKDLALSCGK
KERDAWVTTREYMDAVERRLRSNLANAKL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcttcgggcgagttccgtcccatcccgactctccctgacccgcctcgctcgc
aataattcacagcccgctccccgactgctctcaacgttttctatccgtcctgcccctcct
ttgcctttgaattcttccactgcgcgctcttgtcttccttctacttcctctatccacaac
acctccgccgcaaccactcgtttccaatcctcctttgcccccctgagagcagttagctgg
actgctgcatcatccccctcattgtcccatacacagaagcgcaacatgtcgaccggacgg
aagaagatcaaggtcaagaaccccgtggtggagttggatggtgatgagatgaccagaatt
atctggcaggatatcaaggacaaattcatctatccataccttgacgttgacctgaagtac
tacgacttgggcttggagtatcgcgaccaaaccgatgacaaggtcacggtagatgccgct
gaggctatcaagaaatatggcgtcggtgtcaagtgtgccaccatcacccctgatgaggcg
cgtgttgaggaattcaagttgaagaagatgtggctttctcccaacggaaccatcagaaat
atcctaggtggaaccgttttccgtgagcccatcgtcattccccgcattccaagacttgtt
cctggctggaagaagccaatcatcatcggaagacatgccttcggtgaccaatatcgtgcc
actgatcgtcttgtccccggacccggcaagttggagcttgtctacactcccacaaacggc
gaaccagagcgcattaccgtatatgacttccaaggagccggtatcgcccaggtccagtac
aacaccgacgactccatccgaggattcgctcacgctagcttcaagctggcccttctgaag
ggtctgcccatgtatatgagcaccaagaacaccatcttgaagaaatatgatggtcgattc
aaggatatctttgaggaagtgtacgaggccgaatacaagaaagccttcgaggccaagggt
atctggtatgagcaccgcctgattgacgacatggttgcccagatgatcaagggcgacgga
ggttgcgttatcgccatgaagaactatgatggtgatgttcaatccgacatcgttgctcaa
ggcttcggctcccttggcttaatgacatccactctcaccaccccagacggctctgccttc
gagtccgaagctgcccatggcacagtcactcgccactaccgtgagcaccagaagggtcgt
gagacttccacgaaccccatcgcgtccatcttcgcatggactcgtggcttgatccgccgc
ggtcaactcgacgagactcctgacgttgtcaccttcgctgaacaactcgagcgtgcctgt
atcgaggtcgtcgacgaggagggcatcatgaccaaggatctggctctgtcctgcggcaag
aaggagagagatgcttgggttaccacccgagagtatatggatgccgttgagagacgcctc
cgcagcaatctggccaacgccaagctctaa

DBGET integrated database retrieval system