KEGG   Coccidioides immitis: CIMG_08649Help
Entry
CIMG_08649        CDS       T01114                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cim03036]
    CIMG_08649
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CIMG_08649
Chromosome and associated proteins [BR:cim03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CIMG_08649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 4559831
NCBI-ProteinID: XP_001241486
UniProt: A0A0E1RX01
LinkDB All DBs
AA seq 1093 aa AA seqDB search
MDGRKPPPAMAPKQHAGSSGRQSTLTTNNEREQLVSSFNQLSLAPQAALPRQSPSRTSSQ
SYRTLDKPQQAQHDALAHRSPVPRRTPSINSLREDRRSSTPSLKKRLSTASLRSVQNSNG
VGSPRPSTSRRASHQFLSTPGSMMRPISPSVMSECPSPPPLPTASSIAAEHFEKELALHQ
STDLRSKTVVILQDACYGHRYSRPRTSKAGLESIVERPERLRAGILGVASAYVRMGKRWG
NHRCAPHPDLDLSSLPVPPFQILKTTRTLPLNSPAITHVHGAKWMGELKMMCDAAESRLA
LNGKELVRPNSSGSDSSGSVPKLHEGDLYLCPESLNAFEGALGGVCEAIDTVFESDATRR
AFVCIRPPGHHCSSNFPSGFCWLNNVHVGIAHAAMTHGLTHAAIIDFDLHHGDGSQAIAW
EQNQRAISASRNAPLHKKTRIGYFSLHDINSYPCESGDEAKVMSASVCIDNAHGQSVWNV
HLEPWKDAMEFWQLYNTKYAVLLDKARCFLRSCSQQLRDSPNSTHPKAAIFLSAGFDASE
WEGIGMQRHKVNVPTDFYAKFTSDINRLAEEEDLAVDGRIISVLEGGYSDRALTSGIFSH
LSALADTRNVVVDDMDAQSRLASEMFSRLNLSDKASNAPSCDSTEEPILFDTIWWTGPML
EELEIIAQKPPPAPIRKLREKGQPSFLAHTQASAAKAVTPVRERGVLFSHHATLDEPFSL
PEVDWALAAVELSKAIIPTDRQTSSLKHADLKGENARSKRERHSLTGSTDLESVSERGHM
QLRERKPKAPVIPELQPGNSRSSSRSTRRTTIASSSDLADGALPETPIESLDQTQVVVPQ
HSRKLSVTSSVASVGSAAPRNISLRKPREASSRPVSRAQASTRPATSMGINVQKQRAVGV
GDRSGSRKSTPLDTTSAQSQHGDVDHLSNGVKKLSLKLKVPTPEEHAAREAARIAEERNR
NMSKTAKKTPAAKPTKQIAGKSTSKTSRNATISEAPRAESDTADPRMIPLPSESTPVSST
EHSLAISAGREQHQTTDHPSFPSPPLTPLSPCARPQTTVKSAPPKAYTKEDLPVFTSTSV
IPFGPSRDSNTGS
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcggaaacccccgcctgcaatggcgcccaaacagcacgctggatcgtcaggg
cgacagagcactctcacaacaaacaatgagcgtgagcagctggtgagctccttcaatcag
ctctcgttggctcctcaggctgctttgccccgtcagtccccctcgcgaacctcttcccaa
tcctatcgaaccctcgacaagccccagcaggcgcaacatgatgctctcgcgcaccgttct
cccgttcctcgaagaacacccagcattaactctttgagggaagaccgtcggtcctccacc
ccgtctttgaagaaacgcttgtctaccgcttcgctccgctccgttcagaactccaacggc
gttggctctccgcgccccagcacctcgagacgcgcgtcccaccaattcctatcaacgcca
ggatcgatgatgcgaccaatatccccttccgtcatgtcggaatgtccttcacctcctccc
ctgcccaccgcctcatccatcgctgcggagcatttcgagaaagagcttgcgcttcaccag
tccacagacctacgatcaaagacggtcgtgatccttcaagatgcttgttatggacataga
tattcacgcccaaggacttctaaagcggggttagaatccatagtggagcgcccggaacgt
ctacgcgcagggatcttgggtgtcgcgtctgcgtacgttcggatggggaaaagatggggg
aatcatcgctgtgcacctcaccccgacctagacctaagttcgttaccggtgcccccgttt
cagattctgaaaacgacgagaactttaccgttaaactctccagcgatcacacatgtccat
ggggcaaagtggatgggagaactgaaaatgatgtgtgacgcggcggaatcgcgcttggcg
ctgaatggcaaggagcttgttcgtccaaacagttcaggaagtgatagctctggttccgtg
ccgaaacttcatgaaggtgatttatatctctgtccggagtctttaaatgcgtttgaaggt
gcattgggaggcgtgtgtgaggcgattgataccgtttttgagtcggatgccacacgtcga
gcttttgtatgcattcgtccccccgggcaccactgttcctcaaattttccttctggattt
tgctggctgaataatgtacatgtcggcatcgcgcacgctgcaatgacccacggtcttaca
catgccgcgattattgactttgacttgcatcatggcgatggctctcaggctattgcttgg
gaacagaatcaaagggccatatcggcatccaggaatgcgccactgcataaaaagaccagg
atcggatatttcagtttgcacgatatcaactcatatccgtgcgaaagtggcgatgaagct
aaagtcatgagcgccagcgtctgcattgacaatgctcatggacagtccgtttggaatgtg
caccttgaaccatggaaggacgccatggagttctggcagctctacaatacgaaatacgcg
gtccttctagataaggctcgctgtttcttgcggtcatgctcccaacagttgcgcgactcg
ccaaattctacacacccaaaagctgcgattttcctctctgcgggattcgacgctagtgaa
tgggaagggatcggcatgcagaggcataaagtcaacgttccgacggacttctacgctaaa
tttacgtcagatatcaaccgactcgccgaagaagaagatctagccgtggatggaaggatt
attagtgtccttgaaggaggatatagtgatcgagcgctaactagcggtattttcagccac
ctctcagcgcttgctgatactcgaaatgttgttgtcgacgatatggatgcgcaaagccgc
ctcgcttctgaaatgttcagtcgccttaacctgagtgataaggctagcaatgctccaagt
tgtgactcaactgaggaacccatactttttgatactatatggtggactggacctatgttg
gaagaacttgagataattgcacagaaaccgcctccggcgcctattcgtaagctccgtgaa
aagggtcagccaagctttttggcacacacccaggcatccgctgcgaaagccgtcacccca
gtcagggaacgtggtgttttgttttcacaccatgctactctggatgagccgttctccctt
ccagaagtcgactgggccctggcagcggttgaactgtcgaaggccatcatacctactgat
aggcaaacttcgagcttaaagcacgctgatttgaagggagagaacgcaaggtccaaacga
gagcgccattcgctgacaggatctactgaccttgaaagtgtttctgaacgcgggcatatg
caacttcgggaaagaaagcctaaagcaccggtcatcccagagctgcagcccggaaattca
agatcatcatctcgcagtactcgtcggaccaccattgcatcatccagtgatctggctgat
ggtgctcttcctgaaacaccaattgagtcccttgatcagactcaggtggtggtgccacag
cattcacgaaaacttagcgtcacttcgagcgtggcatcggtgggcagtgcagctcctagg
aatatctctctgcgcaaacctcgtgaagcttccagccgtccagttagccgggcacaagca
agtactaggcctgcgacatctatggggataaatgtgcaaaagcagagagctgtgggagtg
ggtgatcgatcaggatccaggaaatccactccgctcgacaccacctccgcacaatcccag
cacggagatgtcgaccacctttccaatggcgtgaaaaaattaagccttaaactgaaagtt
ccgactcccgaagagcatgctgcgagggaagctgcaagaattgccgaagaacggaataga
aatatgtcaaagacagctaagaagacccctgccgcaaagccgacgaagcagatcgcagga
aagtctacatcgaaaacttcgcgtaatgcgactatttcagaagctccgagagctgagtct
gacaccgccgacccacgtatgattcctcttccctcagaatcaaccccagtctcgtctacc
gagcactcactcgcaatctctgcaggtcgcgaacagcaccaaactaccgaccacccgtct
tttccttctccgccccttacaccattgtcaccctgcgccagaccccaaaccacagtcaag
tcggcccctccaaaagcttacacaaaggaagaccttcctgttttcacctcgacttctgtc
attccctttggcccttcccgcgatagcaataccggttcatag

DBGET integrated database retrieval system