KEGG   Coccidioides immitis: CIMG_08889Help
Entry
CIMG_08889        CDS       T01114                                 

Definition
(RefSeq) viral A-type inclusion protein repeat protein
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif
Pfam: GRIP TPR_MLP1_2 Reo_sigmaC Filament HMMR_N Myosin_tail_1 Fez1 Spc7 IncA CALCOCO1 Macoilin CENP-F_leu_zip CCDC144C TBPIP DUF1192 ATG16 GAS Lzipper-MIP1 APG6 Cep57_CLD_2 EzrA Baculo_PEP_C DivIC TEX12 FapA
Motif
Other DBs
NCBI-GeneID: 4560694
NCBI-ProteinID: XP_001241726
UniProt: A0A0E1RVL9
LinkDB All DBs
AA seq 1188 aa AA seqDB search
MLSRIRGAIDARIAEEQARQRGAQETLSRSNSARRANPSPARRPSTRVKRGNSFLAKNPD
PSEFDAEFVVGDDDSSTRTSTPRPESANNMADGGGELDEKATLNESGSAAPTSLLGKSSG
QTPADLPTDVRVKLRRLDKLESKYQELLKAYRIAHARVLSIEPFEAALRENTPLTSISEP
RALTEYLNQLTLKGDMVVDELKRVTAERDDFKKKLESAEKSTREVWDEVANLKRSQPGDE
KKTAPEGEDVNGNDLPSIQTTSSAGDDSLDNSQKSPTTSITSRAASIRGLFSPRAKPVMS
PPPPPEENEEFFSFDNEIPRLESEVHEKEQEIESLKAQVKTLTGDLSVARESTEGMAHSL
EAATRDVSELRDKNDRLESRFKDERHDLREQIISLESKLRTTESELRRSSTSMDDVNSQL
KKTREELRQIKDTAESQSAEGDGQKSADKKRLEVLQGVVTNLKSQLKDAESTIKSLQTDL
SASKADATRAQRIVDFIDSGLKENEKWKDAKELISGGQSANFEDIRQDLIAPASQLAPVS
TSTPSAPGGKKKNKKKKKGGRSEPEGGTKEAATKQVHEPTPPNISSADAIRELEDKVTKL
GSELAEKDAAIDRLHGKLKGEDNLREEIESLRDDLMNIGQDHVEAKDKVKELLAQKAALE
KTIQDLESEIVTLKTSSASASSDAEKVHKDLMTEFEDLKVKAVTLETDLSAAQQLAASRF
KDLADLRQALQKIQPELRTLRQESADLKTTKEELKNKTAELGRVERKQEDLRVEIKDLKS
AIGDKDAEVRTLNQKIAQETNSRLKAEQALEVAQSDLRYSESQKQEAVEKHEQTSKDLNK
TQEQLQSAKSKVRELEEQVSKLNREIESLHDEIQLKTAQHASAQSLMNSMRDQTSEMAMQ
IKEVRERCESLEEELSDAQRLLSERTREGETMRRLLSEVELRTEHKVRDFKERLETAIEE
RDRAEDEANIIGRRRAREMEELKSKAREAERALRRAEEDKEELEHAQKEWKRRREQFEAE
MERSRQELTDVKEAMAQLRDALDESEKQARELEKERSELRRSVEETNQRLEKLRKTNKSL
SEDLKAIQAGKGRVESGNRSPRSSIDSGRRRGVMSPPPRARNESLARSEATTGPGAGNID
HVYLKNVLLQFLEQKDKNYQKQLIPVLGMLLHFDANDEQRWMSAISSK
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgtatccgaggtgccattgatgcccggattgcagaagaacaagcccgccag
agaggtgcccaggagaccctctcccgctcaaactccgctcgtcgcgcgaatccctctcct
gccagacgtccgagcacaagggtcaaacggggcaacagcttccttgccaaaaatccagat
ccgtcggagttcgatgcggaatttgtcgtcggtgacgatgattcatcgacaaggaccagc
acccctcgcccggagtctgcgaacaacatggccgatggcggcggcgagctggacgagaaa
gccactcttaacgagtcggggtccgccgcacctacctctctactagggaaatcctcgggt
cagacaccagcggatttaccaaccgatgtcagagtgaagctacggaggctggataagtta
gaatccaaataccaagagctcttaaaggcctatcgaattgctcacgcgcgcgtcctgtct
atcgaaccattcgaggctgccctgcgagagaatacaccacttacttcaataagcgagccc
cgtgcgttaaccgaatatctcaaccagctcactctaaaaggagacatggtggtggacgaa
ttaaagagagtaaccgcggaaagagacgactttaaaaagaaacttgaatctgccgagaaa
tccacacgtgaagtatgggatgaggtcgctaatttgaaacgttctcagcccggtgatgaa
aagaagacggctccagagggagaagatgtgaatggaaacgaccttcccagtatccagacc
acttcgtccgctggagatgactccctggataattcccaaaaatcccctacaacatcgata
acctctcgtgccgcttccattcgtgggctgttttctccaagagccaagcccgtaatgtct
ccgcctcctccaccggaagaaaacgaagaattcttctccttcgataacgaaatcccgaga
ttggaatcagaagtacacgaaaaggaacaggagatcgagtctcttaaggctcaggttaag
accttaactggggatctgtctgtggctcgggagtctaccgaaggcatggctcatagtttg
gaagctgcaacacgcgatgtctcggagctacgtgataagaacgatcgcctcgagtcccgg
tttaaagatgagcgccatgacttgcgagagcaaattatatctctagaatcaaagttgaga
acgactgaatctgaattgaggagatcgtccacctccatggacgatgtcaactcccagctg
aagaaaacaagagaggagctccgacagatcaaggatacggctgagtctcagtcggcagaa
ggggatggtcagaaatctgccgacaagaaacggcttgaggttttgcagggtgttgtgacg
aatttgaagtcgcaattaaaagatgccgaatccaccatcaaatctctccagaccgatctc
tctgcaagcaaggccgacgcaacgcgagcacagagaattgttgatttcatagacagcggc
ttaaaggaaaatgagaagtggaaagatgcaaaagaactcatttcgggcggtcagtcagct
aattttgaagatattcggcaagatttgattgcaccggcctcccagcttgctcccgtcagc
acctcaacgccctccgctcccggtggcaagaaaaagaataaaaagaagaagaaaggtgga
agatcagaacctgagggtggcacgaaagaagctgctactaaacaggttcatgaaccaacc
cccccgaatatttcatccgcagatgcgattcgggagctggaggataaagtgaccaagctc
ggttccgagctggcggagaaggatgcggcgatagatcgacttcatggcaagctaaaagga
gaagacaaccttcgtgaagaaattgaatctcttcgagatgacctcatgaacatcggccag
gatcacgtggaagcaaaggataaagtcaaggagttgctggcacaaaaggctgcgcttgag
aagacaattcaagatctcgagagcgaaatagtgaccttaaaaactagctctgcttcagct
tcatctgatgccgagaaagtccacaaagatctaatgaccgagttcgaggatttgaaggtc
aaagccgtaactttagaaaccgacctctcggctgcgcagcaattagccgcatctcggttt
aaagacctggccgacttgcgtcaggcattgcagaagatccaacccgagttacgaaccctc
cgccaagaatccgcggatctaaagactacaaaggaggagttgaagaacaagacggcagag
cttgggcgcgttgagagaaagcaagaagatctacgcgtcgagatcaaggatctcaaatcg
gccattggcgataaggatgccgaagtcaggacactcaatcagaagatcgcccaggagacc
aatagccggctgaaggctgagcaagcgttggaggttgcgcagtcggaccttcgatactca
gaaagccaaaaacaggaagcagttgagaagcacgaacagacgtcaaaggaccttaacaag
acacaagaacaactccaatccgccaaatccaaagtgcgagaattagaagagcaagtgtcc
aagctcaaccgagagatcgagagtttacacgatgagatacagctcaaaacggcgcaacac
gcaagcgcccagagcctgatgaacagtatgcgcgatcaaacttcggagatggcaatgcaa
attaaagaggtacgtgagagatgtgagagtttagaggaagagctttcagacgcccagcgt
cttttatcggagcggacaagggaaggcgaaaccatgcgacgactgctctcggaggtcgaa
ctgcgaacagaacacaaggtcagggactttaaggagcgactggagaccgccatcgaagaa
cgagaccgggccgaggatgaagctaacattattggccgcagacgcgcaagggaaatggag
gagctcaaatcaaaagcacgagaagcagaacgggctttacgaagagcggaggaggacaag
gaggaacttgaacatgcccagaaagagtggaaacgacgacgagaacagtttgaagcggag
atggagcgatcaagacaggaactcacggatgtgaaggaggctatggcccaattacgtgac
gcactggatgagagtgagaaacaggcgagggaactggagaaggagagatccgaactgcgc
cggtcggtcgaagaaaccaaccagcgactcgagaagctaaggaagacaaacaaatcccta
tccgaggacctgaaagcgatccaagccggaaagggacgcgttgaatccggcaatcgttcg
cctcgatcgtccattgattcaggcagacgccgcggagtgatgtctccgccgccgcgggca
cgaaacgaatctctcgcccgcagcgaggcgacgaccgggccaggagccggaaatatcgat
cacgtctacctcaagaatgtactgctgcagttcctggagcaaaaggataaaaactatcaa
aaacagctgattcccgtgctagggatgctgctgcattttgatgccaacgatgagcagaga
tggatgtctgctatatcctcgaaatga

DBGET integrated database retrieval system