KEGG   Coccidioides immitis: CIMG_09216Help
Entry
CIMG_09216        CDS       T01114                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cim  Coccidioides immitis
Pathway
cim03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CIMG_09216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cim03400]
    CIMG_09216
Enzymes [BR:cim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CIMG_09216
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CIMG_09216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT RTT107_BRCT_5 VWA_3 DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 4558489
NCBI-ProteinID: XP_001239595
UniProt: Q1DKE7
LinkDB All DBs
AA seq 985 aa AA seqDB search
MDRLNNVGGETERELDEKYPNRPRNKHSTLPFHDLFLTLFNPLNGNKKRPTGPAAARKKL
GPHGGQQTLSPQELRRDIIQRFISRWRKEVGNDIYPAFRLIIPEKDRDRAMYGLKEKTIG
KLLVKIMKIDKNSEDGFNLLNWKLPGQSMASRMAGDFAGRCYEVISKRPIRTDVGNMTIQ
EVNDKLDVLAATSKEDEQIPVLEEFYRNMNPEELMWLIRIILRQMKVGATERTFFEIWHP
DAESLFSISSSLRRVCWELYDPNVRLEADEARVTLMQCFQPQLAQFQMHSFPKMIERMRL
SPDDPTFWIEEKLDGERIQLHMMSDDSIPGGKRFGFWSRKAKDYTYLYGNGFYDENGALT
RHLKDAFADGVDNIILDGEMITWDPEQDAPLPFGTLKTAALSEQRNPFSATGQRPLFRIF
DILYLNDKALTRYTLRDRRRALEASIKPVHRRLEVHTYEIGNSAADIEPQLRKVVAEASE
GLVLKNPNSPYRLNDRHDDWMKVKPEYMTEFGESLDCVVIGGYYGSGKRGGGLASFLCGL
RVDEAQVRQGASPMKCYSFLKVGGGFTAPDYANIRHHTDGKWKDWNPKKPPTEFIELAGG
DAQYERPDVWIRPDESVVLCVKAASVTPSDQFRLGLTVRFPRFKRLRMDKDWKSALSIQE
FMDLKANAEREQKEKEFKIDNSRRKRAKRAVKKPLTIAGYDESKRAGFTGPSGHVFEGMN
FFVITDSVEPEKKSKLELEQLIKANGGKIYQTHTAAPNTLCIAERRTVKVASVQKVAKES
IIRPSWLFDCIKQNEVDKGLPDLLIPFEPRHMYFTVKSQEEEIARHVDEYSDSYARDITP
NELSKLLVSMPLIPNLPPPHISKTETQIQERESTFQELRGWLFKNQVLHFVKRRSDSMLS
LPLRLASNLARFAGASVANELEDKSITHVVIDTDSQPADVSALRSAISKRVAAGRRIPHL
VTIAWIQDSWKAESLLDEERFAPTA
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggaccgattgaacaacgttgggggagagactgagagggagctcgatgagaaatatccc
aaccgtccccgcaataaacactcgacattacctttccatgaccttttccttacgcttttc
aatcctctaaatggaaacaagaagagaccaacaggacctgccgccgctcgcaagaagttg
ggaccacatggaggacaacagaccctttccccgcaggaattacggcgagatattattcaa
cgtttcatttcacgatggagaaaggaagtagggaacgatatctatcctgcgtttcgattg
atcatacctgagaaagatcgagatcgtgcgatgtatggcttgaaagagaagacaattgga
aaactgctggttaaaattatgaaaattgataaaaactccgaagatggatttaaccttttg
aactggaagcttccaggccaaagcatggcgagtcgaatggctggcgattttgctggtcgc
tgctacgaagtgatatcaaagcgacctataagaacggatgttggcaacatgaccatccag
gaggtcaatgacaaactggatgttctagctgctaccagtaaggaagatgagcagatacct
gttcttgaagagttctacagaaacatgaaccctgaagaactgatgtggctcataagaatc
attttgcgtcaaatgaaagttggagccactgagcggacgttcttcgagatatggcatcca
gatgcagagagcctgtttagcatatccagcagccttcgccgagtttgttgggaattatat
gacccgaatgtccgcctggaggccgatgaagcacgggtgacgctcatgcaatgctttcaa
cctcaattggcgcagtttcaaatgcattcatttccaaagatgatcgagaggatgcggctc
tcccccgacgatccaacgttctggatcgaagagaagctagatggtgagcgaatccagctt
catatgatgtccgacgactccattcctggaggtaaaagatttggattctggtcacgtaaa
gcaaaggattatacatatttgtatgggaacggattctacgatgagaatggagcattgacg
cgacatcttaaagatgcttttgcagatggtgttgataacattattctcgatggagaaatg
attacctgggacccagaacaagacgcaccattgccctttggcacgctcaaaacagcagct
ttatcagagcagaggaacccattctcggctactggccaaaggcccttatttcggattttc
gatatcttgtacctcaatgataaagccttaaccagatacacattacgggatagaagacga
gcccttgaagccagtatcaaaccagtccatcgtcgtttggaagttcatacctacgaaatc
ggtaattctgctgcagatattgagcctcagctccggaaggtggtggcagaggcatctgaa
gggcttgttcttaagaatccaaattcaccttatcgtctgaatgaccgccacgacgattgg
atgaaagtgaaacctgaatatatgacggagtttggtgaatcccttgattgcgttgtgatc
ggtggatactatggctcaggtaaacggggcggtggattagcaagttttctgtgtggactg
agggttgacgaagcccaagttcgacagggggctagcccgatgaaatgctactcatttctt
aaagttggaggaggattcacggctccagactatgcgaatattcgccaccataccgacggc
aaatggaaagattggaatcccaagaagccgccaactgagtttattgaattggctggtggt
gatgcacagtacgaacgccctgacgtatggattcgacccgatgagtctgttgttctgtgt
gtcaaagcagcctctgtgactcctagtgaccagtttcgattggggttgacagttcgcttt
ccgcgattcaagcggttacgaatggataaggattggaaaagcgccctgtccattcaagaa
ttcatggacttaaaggcgaatgcagaaagagagcagaaagaaaaggaattcaagatcgat
aactcccgaagaaaacgggcgaagagggctgtcaagaaaccgcttacaattgctggatac
gatgaaagcaaaagggccggttttacaggtccatcagggcatgtttttgaaggaatgaat
tttttcgttattacggattcagttgagccggagaagaagtccaaacttgagctggaacaa
ttgatcaaagcaaatggcgggaaaatatatcaaacccatacggcagcaccgaatactctt
tgtattgcagagagaagaactgttaaggttgcatctgtgcaaaaagtagcaaaagaaagt
atcattcgtccgtcttggctgtttgactgcattaagcagaatgaagtcgacaaagggcta
ccggatttgttgatccccttcgaaccgagacatatgtattttacggtgaaaagccaagaa
gaagagatagcccgacatgtggacgaatattcagatagctacgcgcgagatattacccca
aatgagctaagcaagcttcttgtttcgatgcccctaatccctaatctcccaccaccccac
atttcaaaaacggaaacccagatacaagaacgagaaagcaccttccaggagctgcgaggc
tggctattcaaaaatcaagtgctacattttgtcaaacgtcgatcggattccatgctgtcg
ctccctctacgtcttgcgtctaatcttgctcgattcgcgggtgcttcggtggcaaatgaa
ctggaggacaaaagcatcacccatgtcgtcattgacacggacagtcaaccggctgatgtt
tctgctttgcgctctgcgatatcgaagcgtgtagctgctgggagaagaattccgcatctt
gtgactattgcctggatccaagacagctggaaggcagaatcattgctagatgaagagcgg
ttcgctccgaccgcctag

DBGET integrated database retrieval system