KEGG   Coccidioides immitis: CIMG_13675Help
Entry
CIMG_13675        CDS       T01114                                 

Gene name
CIMG03063
Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cim  Coccidioides immitis
Pathway
cim00052  Galactose metabolism
cim00500  Starch and sucrose metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CIMG_13675 (CIMG03063)
   00500 Starch and sucrose metabolism
    CIMG_13675 (CIMG03063)
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CIMG_13675 (CIMG03063)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 24165302
NCBI-ProteinID: XP_001243622
UniProt: J3KAI9
LinkDB All DBs
AA seq 224 aa AA seqDB search
MAVIPGLKISGLLFSIGASAMALGAFYPFFCNHNEIEMPRQEFYVWGSVSEAARKAIEIR
YKLIAYIYTAVYYQTQTGKPVLNPLFYLYPEDENTFAIDLQFSYGDAILVSPVTTENATS
VEACLPKDIFYDYYTGAKILGKGQNVRINNVPLTHIPLHIRGGTVVPMRFRSANTTTELR
EQPLNILIAPGLHGDASGSLYLDDGESLEQECATEINFDYNNGK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctgttattcccggattgaagatttccggtcttctctttagtatcggtgccagtgcc
atggcgctaggcgcgttttatccgttcttctgcaatcacaacgaaatcgagatgcccaga
caggaattttatgtctggggttctgtgtctgaggctgcgcggaaagctattgagataagg
tacaagttaatagcctatatctatactgccgtttattaccagacccagactggaaagcca
gttctcaatcctctcttttacctgtatcctgaggacgaaaataccttcgcgattgatttg
cagttctcctacggcgacgctatccttgtgagcccggtaacaacagaaaacgccaccagc
gtggaggcctgtcttccgaaagatatattttacgattactacactggagccaaaattctc
ggcaaaggacagaatgttcgtattaacaacgttcccctgacccatatccctcttcatata
cgcggtggtactgtggttcccatgcgatttaggagtgcaaatactacaacggaactgaga
gagcaacccttgaacatcctcatcgcccccggtctgcatggggatgcgtccggaagtcta
tatcttgacgatggagaatcgttagagcaggaatgtgccacggagatcaattttgactat
aacaacgggaaatag

DBGET integrated database retrieval system