KEGG   Ciona intestinalis (sea squirt): 100175603Help
Entry
100175603         CDS       T01056                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00020  Citrate cycle (TCA cycle)
cin00480  Glutathione metabolism
cin01100  Metabolic pathways
cin01200  Carbon metabolism
cin01210  2-Oxocarboxylic acid metabolism
cin01230  Biosynthesis of amino acids
cin04146  Peroxisome
Module
cin_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100175603
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100175603
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100175603
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     100175603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 100175603
NCBI-ProteinID: XP_002124548
Ensembl: ENSCING00000008658
UniProt: A0A1W2WAC0
LinkDB All DBs
Position
Unknown
AA seq 446 aa AA seqDB search
MALSKCQQVFSKLRQCTNLASVYGMNNKHVQRQYTTDKRIQVANPVVEMDGDEMTRIIWE
MIREKLILPYMKVDLKYYDLGMEYRDQTDDQVTIDSALATLKYNVAVKCATITPDEDRVV
EFNLKQMWKSPNGTIRNILGGTVFREPIMCKVVPRLVPGWEEPIVIGRHAHGDQYKATDF
VAPGPGKLDLTYTPANGGAPVNMEVYDFKDGGGVGMAMYNTDASITDFAHSCMQVALQKK
WPLYMSTKNTIMKKYDGRFKDIFEDVFQKNYKKDFDANGMWYEHRLIDDMVAQVLKSSGA
FVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTVESEAAHGTVTRHYREHQKGNP
TSTNPIASIFAWTRGLEHRGKLDGNPDLVKFCQTLEKVCVDTVNNGVMTKDLAGCIHGLK
NVKLNEHYVITTDYLQAVEEGLKKAL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctctttcaaaatgccaacaagttttcagtaaacttcgccaatgcactaacctagct
tctgtatatggaatgaacaacaaacatgtacaaagacaatatacaactgacaagcgaatt
caagttgcgaatcccgttgtggagatggacggagatgaaatgacaagaatcatctgggaa
atgataagagaaaagcttatcttgccttacatgaaagttgatttgaaatactatgatctt
ggaatggaatatcgagaccagaccgatgaccaagttaccattgactcagcattagcaacc
ttgaaatacaacgttgctgtgaaatgtgcaactattactcctgatgaagacagagttgtg
gagttcaacttgaaacaaatgtggaaaagtccgaacggaacgatccgtaacatcttggga
ggaaccgtcttccgtgaaccgatcatgtgcaaagttgtcccgaggttggttcctggttgg
gaagagccaatcgtgataggaagacatgcacatggtgatcagtacaaagctactgacttc
gtagccccaggaccaggaaagcttgacctaacctacacacctgctaatggtggtgcacct
gttaatatggaagtgtatgacttcaaggatggtggtggtgttggcatggccatgtacaac
actgatgcttcgatcaccgactttgcccacagttgcatgcaagttgctttgcaaaagaaa
tggcctctctatatgagcactaagaatacaatcatgaagaaatatgacggaaggttcaag
gacatctttgaagatgttttccaaaagaattacaagaaagattttgatgccaacggtatg
tggtacgaacacagacttattgatgatatggtagcccaggttcttaaatcatccggtgca
tttgtatgggcgtgtaagaactatgatggggatgttcaatcagatatcctggctcaaggt
tttggttcccttggtttgatgactagcgtgttggtttgtcctgatgggaaaactgttgaa
tctgaagccgcccatggcacggttacccgacattacagggaacatcagaagggcaaccca
accagcacgaatcccatcgcttccatctttgcatggactcgtggtcttgaacacagaggc
aaactcgacggtaatccggacctggttaaattttgccaaactttggaaaaggtttgcgta
gatacggttaataatggagtcatgacaaaggatctagcaggctgtattcatggccttaaa
aatgttaaactcaatgagcattacgtcataacaacagactatctgcaagctgtggaagaa
ggcttgaaaaaggcgctttaa

DBGET integrated database retrieval system