KEGG   Ciona intestinalis (sea squirt): 100176340
Entry
100176340         CDS       T01056                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X2
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100176340
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100176340
NCBI-ProteinID: XP_002130019
Ensembl: ENSCING00000018567
UniProt: H2XWE5
LinkDB
Position
14
AA seq 155 aa
MADKKPPVRQLQKLPGVRSARRNLFGRDDRIVDDLERDAEELNSKEQKRFSDTWNFDAAN
TQPLDGRFEWDTGVPLNQRTRLLHVPPIGNADSHNDSELVEVKNSTESKNEELPPTGNSS
SVGSCGSSENQSKRRKLSSESTDDHVPATSKSPRL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcggacaaaaaacccccggttcgacagctccaaaaactcccaggagtgcggtctgcg
cggagaaatttatttggtcgagatgatagaattgtggacgatttagaaagagacgctgaa
gagttgaacagtaaagaacaaaaacgattctcggatacctggaactttgatgcagccaat
acccaaccattagatggcaggtttgaatgggacaccggcgttccgctgaatcaacgaact
cgactattgcatgttcccccgattggtaatgcagattcacataacgatagtgagcttgta
gaagttaaaaactcgacagaatcaaaaaatgaagagttgccacctacggggaattcctct
tctgtaggctcatgtgggtcttccgaaaatcaaagtaaaagaaggaaactatcttcagaa
tcaactgacgaccatgtacccgctacatcgaagtcgccccgactgtga

DBGET integrated database retrieval system