KEGG   Ciona intestinalis (sea squirt): 100178732Help
Entry
100178732         CDS       T01056                                 

Definition
(RefSeq) dipeptidyl peptidase 4
  KO
K01278  dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cin01002]
    100178732
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100178732
   04090 CD molecules [BR:cin04090]
    100178732
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     100178732
Peptidases [BR:cin01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100178732
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100178732
  Exosomal proteins of epithelial cells
   100178732
  Exosomal proteins of colorectal cancer cells
   100178732
CD molecules [BR:cin04090]
 Proteins
  100178732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPPIV_N Peptidase_S9 Peptidase_S15 LIP DLH
Motif
Other DBs
NCBI-GeneID: 100178732
NCBI-ProteinID: XP_002130673
Ensembl: ENSCING00000002895
UniProt: A0A1W2WN61
LinkDB All DBs
Position
Unknown
AA seq 797 aa AA seqDB search
MLRLKLFVAGTSAVALLITLLVVYQDSGFSEIKSQEIRKSLVENRAGKTKFTFNDIFGSK
FSYKSVNPRWVSDHMYIIQAANKDIILKCAMDQHEFLIMPGAIYTDKGARSYQVSASQNF
VLLLTDYVKGWRHSYNGTYIVYDVNQDMIRDDITFPSDVQYITWSPVGDAVAYVYDFDIY
YRADVNDTTTNDIRITDDGSANSVYNGIPDWVYEEEMISTNNVIYFSPDGGKLAYAQFND
TECSHIQFSRYDSKQYPEMIDVSYPKAGTTQPTNKVYVYDIASGSNNEAIPPTTLSSGDY
LFSRAVWANESRVAVTWCNRLQTWSMMVMCDITADGSMTCPSVPQFEHKTTTGWLYQRRP
YWIPVFGQSAEEYFVVLPNNKWQHLARADNTGNKEFLTEGEYTVTSYSASYPAVEFYKSA
NDYVYFLSTFDGTENRQVYRRKGRLLPTMSAAEPPECITCPLRTEYPERCNIATSSFSKG
GSRVVIACRGEGAPLYIQFTVNHTATDPANVLIDKVLLEENLDLVDNIAATEMPVKSYGN
IDSKTGYKFRYERLDPPNFDVNKKYPLLIEVYAGPGYQNVDAFWSRSWGSAYVPAGLGVI
LVRIDGRGSNFYGDEFMHEVYQGLGQKEIEDQIEAAEYFGKLPEVDSSKIAMWGWSYGGF
ATSHALGLNTGILKCGMAVAPLVDWRYYDTIYAERYMGLPAINTDGYDKANIINKAENFP
QSSYYLIHGTADDNVHFQNSAQLSKALVENDIRFNNFFYADQDHSINVGNAYTHVYKVLT
RQLCQCFNLQVPDDVWN
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcttaagttgtttgttgcgggaacgtcggctgtcgccttactcatcacacta
cttgtagtgtatcaagattcaggattcagtgaaattaaatcacaagaaattcgaaaatct
ttggtggaaaatcgggccgggaaaacaaagtttacatttaatgatatttttggatcgaag
tttagctacaagtcggttaatccaagatgggtatcggatcacatgtacattattcaagcc
gccaataaagacatcatattaaaatgtgccatggatcaacatgaatttctcatcatgcca
ggagcaatttatacagacaagggcgctcgttcctaccaagtctccgcctcccaaaacttc
gtgctcttattaaccgattacgtaaagggttggagacattcttacaacggaacatacatt
gtgtatgacgtcaatcaggatatgatccgagatgacattacattcccaagtgatgttcaa
tatatcacttggtctccggtgggcgatgctgtggcttatgtttacgacttcgacatttat
taccgagctgatgtcaacgacactacaacgaatgatatcagaattactgacgacggaagt
gcgaattctgtttacaatggaattccagactgggtatacgaagaggaaatgatttcgacc
aacaacgtaatctacttttcaccggacggaggaaagttggcgtatgctcagttcaatgac
actgaatgttctcatattcaattctcccgttatgattccaagcaatacccagagatgatt
gacgtatcttaccccaaggcaggcacaacacaaccaacaaataaagtttacgtttatgat
attgcatcgggaagtaacaacgaagcaataccaccaacaacattatcatcaggagactat
ctgttcagccgggcagtatgggcaaatgagtcacgtgttgcagtcacgtggtgtaaccga
ttacaaacttggagcatgatggtgatgtgtgacattacggctgatggaagcatgacgtgt
ccaagtgttccacagttcgaacacaaaacaacaaccggttggttataccagagacggcca
tattggattcctgtgtttggccaaagtgcagaagaatacttcgttgttctgccaaacaat
aaatggcagcatttggcaagagcagataacactggaaacaaggaattcctaactgaagga
gaatataccgtgacatcatatagcgcatcctacccagcggttgagttttacaagagcgca
aacgactacgtgtattttctttctacgttcgatggaacagagaatcgtcaagtgtacaga
aggaaaggaaggctgttgcccaccatgtccgctgccgaaccaccagagtgcataacatgt
ccgctcagaactgaatatccggagaggtgtaatattgctacgtcgtcattcagcaaaggt
ggcagtcgcgttgtcattgcatgcagaggtgaaggagcgcctctttacattcagtttacg
gtcaaccacacagcaacggaccctgctaatgtcctgatcgacaaagttctgttggaagag
aatttggatcttgtagacaatatagcagcaacagaaatgccggtgaaatcgtatggcaat
attgatagcaaaacaggatacaaattccgttacgaacgcttggaccctccaaatttcgat
gtcaacaagaaataccctctgctaattgaagtttatgctggaccaggataccagaacgtt
gacgccttttggtcaagaagttggggttcagcatacgttcctgcggggttgggtgtcata
cttgtaagaatcgatggacgaggttctaacttttatggggatgaattcatgcacgaagtt
taccaaggacttgggcaaaaagaaatcgaagatcaaattgaggctgccgagtacttcgga
aaactccccgaagttgattctagcaagatagccatgtggggctggtcatatgggggcttt
gcaacatctcatgcgcttggattaaacacaggaattctgaaatgcgggatggctgtagcg
cctctggtggattggagatactacgacacaatatatgctgaaaggtacatgggtctacca
gccataaatacagatggttacgataaagcaaacataataaacaaagctgaaaacttccct
cagtcaagttactacttgatacacggaacagcagatgataatgttcatttccaaaactct
gcgcaactatctaaggcattggtggagaatgatattcgctttaacaacttcttttatgct
gaccaagaccattcaattaacgttggcaacgcatatacccacgtgtacaaggttctaaca
cgacagctgtgtcaatgtttcaatctacaagttcccgacgatgtttggaattag

DBGET integrated database retrieval system