KEGG   Ciona intestinalis (sea squirt): 100178986Help
Entry
100178986         CDS       T01056                                 

Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3-like
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00310  Lysine degradation
cin00514  Other types of O-glycan biosynthesis
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100178986
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100178986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cin01003]
    100178986
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     100178986
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     100178986
    2.4.1.66  procollagen glucosyltransferase
     100178986
Glycosyltransferases [BR:cin01003]
 O-Glycan biosynthesis
  O-linked Gal type
   100178986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anp1
Motif
Other DBs
NCBI-GeneID: 100178986
NCBI-ProteinID: XP_002131164
Ensembl: ENSCING00000007889
UniProt: A0A1W2WLI5
LinkDB All DBs
Position
1
AA seq 729 aa AA seqDB search
MVSLLSVSVTLFCLFLSIEHAKSQETTELLIVTVATDETDGFVRFKESLDYFNLTVLVIG
MHEEWVGGDLSRGMGGGQKINMLKRSLESYKDNTNLVLFFTDSYDVVFTGGKEEIMSKFN
KFNAKLVFSAESTIWPDASLKDLYPEVTVGKRFLCSGGIIGYAPTFWEAINMQDISDTFD
DQLYYTKIYLNTTLRAKLNATLDHTSQLVQNINFAKSELEIVQQGDLSRIQNTVYRTYPV
VIHGNGPSKLELNYMANYIPDGWHSNFGCRKCEWNLLQLPEAEENLPTVQLAIFIEPNTP
FIPEFLSRIQQLDYPKSKITLFIHTNEENTERYVSQFLLRHRVKYQGVQVISPHDGVHEA
TARNMALDHCILKNCDYQLSIDGNVQITNSSLIKFLMTKNKQVVGPLVKLHEKLWSNFWG
ALNADGYYARSADYISIVNRERTGIWNIPFISSVYLMKSETIRFLLSRVPQPYFYEDMDA
DMAFCAHVRQEGIFLHVTNEAEFGRLLSKANVNPGPVHPDLWQIETNKKDWEEKYIHPDF
WNLTLENTEVSQPCPDVYMFPLFTEEMADAIVDVMENHGEWSGGKNKDDRLAGGYENVPT
VDIHMNQVNYEKQWLHMLATYPTHIIQKVYPGYYTKASSIMMFVVRYRPSEQSFLRPHHD
SSTWTMNVALNTYGEDYEGGGCRFLRYDCSVTQIPKGYALVHPGRLTHYHEGLQTMEGTR
YIAVSFVDP
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggtctccctgttgagtgtttctgtaactttgttctgtttgtttttatcgattgaacat
gccaaatcacaagaaacgactgaacttttgatagtaactgtagcaaccgatgaaactgat
gggttcgtgaggttcaaggagtctcttgattattttaacttaaccgttttggtgattgga
atgcatgaggaatgggttggtggagatttaagtagaggtatggggggaggacagaaaatc
aatatgttaaaacgaagtttggaaagttacaaagacaacaccaacctggtcctgtttttc
acagatagctatgatgtggtgtttactggaggcaaggaagagataatgtccaagtttaat
aagttcaatgcaaaattagtcttttcggcagagtcaacaatatggccagatgcgtctcta
aaggatttgtatccagaagttacagtgggcaagcgatttttgtgctctggtggaatcatt
ggttatgcaccaacattttgggaggccattaatatgcaggacatttcagacacttttgat
gaccaactgtactacacaaagatataccttaacactactctcagggctaaacttaatgct
acgttagatcacacaagccaacttgttcaaaatattaattttgccaagagtgaattggaa
atagttcagcaaggagacctctcaagaatacaaaatactgtgtacaggacttatccagtt
gttattcacggaaatgggccgtcaaagctggagcttaattacatggcaaattatattcct
gatggatggcatagcaatttcggctgcaggaaatgtgaatggaaccttctgcagttgcca
gaagcagaggaaaatcttccaacagttcagcttgcaatatttattgagcccaacactccg
tttatcccagagtttctttcaaggattcaacagttggattatccaaagtcaaaaattaca
ttgtttatacatacaaatgaagagaacacagaacgttatgtttcacaattcttgctacgt
caccgagtaaagtatcaaggtgttcaagtcatctcaccacacgatggtgttcatgaggca
actgctagaaatatggctttagatcattgtatacttaagaattgtgattatcagcttagt
attgatggcaatgtacagataacaaactctagccttattaagtttcttatgaccaagaat
aagcaggtggttggtccacttgtaaaactgcatgaaaaactgtggtccaacttttgggga
gctttgaatgcggatggttactatgcgagatcagctgactacatctccattgtaaataga
gaacgaactggcatatggaacattcctttcataagctctgtgtacctcatgaaaagtgaa
acaataaggttcttactaagccgtgtaccacagccatatttctatgaagatatggacgct
gacatggcattttgtgctcatgttcgacaggagggtatattcttgcatgttacaaatgaa
gcagagttcggccgcttgttgtcaaaagcaaatgttaatcctggccctgtacatccagat
ttgtggcaaattgaaaccaataaaaaggattgggaagagaagtacattcatcctgacttt
tggaatctaaccttggaaaacactgaagtatcacagccatgcccagatgtttatatgttc
cctctctttactgaggaaatggcggatgcaattgttgatgtcatggaaaatcacggagaa
tggtcaggtggtaaaaacaaggatgataggttagctggaggatacgaaaatgtacccact
gtcgatattcacatgaaccaagttaattatgagaaacagtggcttcatatgctggcaaca
tatcctactcacataatccagaaggtgtatcctggctattacacaaaggcaagttctatt
atgatgttcgtggtgaggtataggccaagtgaacagtcttttctacggccacaccatgat
tcttcaacatggacaatgaacgtagctttgaacacatatggtgaagactacgagggtggt
ggatgtcgatttctgcgatatgattgctctgtgacacaaattcctaaagggtacgcactt
gtccaccccggtagattaactcactatcatgaagggctgcagacaatggaaggaacacga
tacattgctgtctcctttgttgatccgtaa

DBGET integrated database retrieval system