KEGG   Ciona intestinalis (sea squirt): 100179130Help
Entry
100179130         CDS       T01056                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00052  Galactose metabolism
cin00500  Starch and sucrose metabolism
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100179130
   00500 Starch and sucrose metabolism
    100179130
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100179130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100179130
NCBI-ProteinID: XP_018671115
Ensembl: ENSCING00000004798
UniProt: A0A1W5BFM4
LinkDB All DBs
Position
Un
AA seq 895 aa AA seqDB search
MHFLWWLVLAISCEAALGYTAATCPSTVPEWSRVDCYPESGSNEASCNSRGCMWCEASVQ
GPPWCFYDDATTAAPPGEGCSSCSSCSNKVDCYPEAGSSEGGCYDRGCLWCPSNVPNEPW
CLVPDGGAIVNPPIQTLDVLLTSQKPRESIVILVEELLNLDSAGCIWCESNTNGVPWCFF
NTTNLPEGIDDDERVNCIPEGGFSPSLCTERSCAFANTNSPNAPMCYFQNDQYGYSMQGT
PVATYNGYRVTLNRIHTSTLFGDDVDTVTLDVTFDTQSRIHIKFYDSSEDRFEVPLTING
ADPSPPSNPLYDIQFFNDPSFYFKVIRQSTGAVLLDTSLGGLTFSNQFLQIATRVPTKTM
YGFGEQEHQTLAHTFEWESFGMYARDQPPDPGANLYGTHPFYVSVEDDGKSHGVLFLNSN
AQDVTLTPAPGVVYRTIGGVLDMYVFLGPEPNSVIEQYNTAIGTPFMPPYWSLGFQLCRY
GYGSLDVVKATVARMDAYDIPMDVQYGDIDYMDERRDFTYDHTNYAGLPDYVKQLQSGGK
HYIIILDPCITEDDPAGTYPPYDIGASMNVFVTESDGVTPASGRVWPPGQCAFPDYTNPD
TETWWTDQCVDFHKTINFDGLWIDMNEPANFVAGSTSGCATNALNNPPYKPKIWGDILAD
KTMCPDHLHKLGNHYDVHNLYGWSQSNVTILSATAATGKRPFVVSRSTYVGSGQWAAHWL
GDNNSDWHDLKMSVIGMLEFNMFGIPYVGADICGFNGDAQEELCDRWMELGAFYPFSRNH
NGLGYKEQDPAAWGDAFAARSRAVLRTRYTLLPYLYELFYTAHTAGTGIVRPLSFEFIND
VNTITIDEQFMWGPALLFSPVLYQGETSVSAYFPDARWYCSHLFIFLLTFATAFD
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcttatggtggttagtccttgccattagctgtgaagctgcattaggctacaca
gcggccacttgtccatccacggtcccggaatggagccgagttgattgttacccggagtct
ggatccaacgaagcgagctgtaatagcagaggttgtatgtggtgtgaagcgtcagttcaa
ggccctccgtggtgtttttacgatgatgcaacgactgcagcgcctccaggggaaggctgc
tcgtcctgtagttcatgcagcaacaaagtagattgttaccctgaagctgggtccagtgaa
ggcggttgttacgaccgtggttgtctatggtgtccatctaatgttccaaatgaaccatgg
tgccttgttcctgatggaggtgcaattgtgaacccaccaatccagacactggatgtcctt
ctgacatcccagaagccgagagaatcgattgttatcctggtggaggagcttctcaatctg
gatagtgctggctgcatttggtgcgagagcaatactaatggcgtaccatggtgttttttc
aacacaaccaatcttccagaaggtattgacgatgatgaaagagtcaattgcattcctgaa
ggtggtttctctccatcactttgcactgaaagatcatgtgcttttgcaaacaccaactct
ccaaatgccccaatgtgctattttcagaatgatcaatatgggtactcaatgcaaggcacc
cctgttgcaacctacaatggatatcgtgtaactcttaacagaatccacacttctacttta
tttggtgatgatgtagacacagtgacgctggatgttactttcgatactcagtccagaatc
cacattaagttttacgattcctctgaagatcgatttgaggttcctcttacaatcaatgga
gcagacccaagccccccttcaaacccactttatgatatacagtttttcaatgatccttct
ttttactttaaagtgatcagacaatccaccggagctgttctactcgatacttcattaggt
ggtttgaccttcagtaatcagttcctgcagatcgcaactcgtgttccaaccaaaacaatg
tatgggttcggtgaacaagaacatcaaacgcttgctcacacatttgaatgggagagcttt
ggaatgtacgcgagggaccaacccccagatccaggtgcaaatctctatgggactcaccca
ttctatgtatctgttgaagatgatggaaaatctcacggagttcttttcctcaattccaat
gcacaagatgtgaccttgacaccagcacctggcgttgtgtacagaactataggaggtgta
ttggacatgtatgtcttccttggtccagaaccaaacagtgtaattgaacagtataacact
gccattggaactccattcatgcccccatattggtcccttggattccagctttgtcgttat
ggttacggaagcttggatgttgtgaaggccactgtggcaagaatggatgcttatgatatc
ccaatggacgttcagtatggtgatattgactacatggatgaacgaagagacttcacttac
gatcataccaactatgctggcttgcctgattatgttaaacagctacaaagcggtggaaag
cattatattattatcttggatccctgcatcactgaagacgacccagctggtacttaccca
ccttatgacataggagcttcgatgaatgtgtttgttaccgagtcagatggagtaactcct
gcatctggacgagtgtggcctcctggtcaatgtgcatttccagattacaccaacccagac
actgaaacctggtggacagatcagtgtgtagacttccataagacaatcaactttgatgga
ctttggattgatatgaacgaaccagcaaactttgtggccggcagcacgagtggttgcgca
accaatgctcttaacaacccgccttataaaccaaagatctggggtgatatacttgcggat
aagaccatgtgtcctgatcatttgcataaacttggtaaccattacgatgtgcataacttg
tatgggtggagtcaatctaatgtgacgatactatctgccacagcagcaaccggtaagcga
ccattcgtagttagcagaagtacgtacgttgggtcgggacaatgggcggcacattggctt
ggtgataacaactctgattggcatgatctgaaaatgtcagtcattggaatgttggaattc
aacatgtttggaataccttatgttggagctgacatctgtgggttcaatggtgacgctcag
gaagaactttgcgatcgttggatggaacttggtgcattctacccgttctccagaaaccat
aatgggctaggatacaaagagcaagaccctgccgcatggggggatgcattcgctgctcga
tcgagggcagtacttcgtactcgatatactttgctaccatatttgtacgagctcttctac
acagcacacactgcaggtactggtattgtgcgacctctatcttttgagtttattaatgac
gtaaacacaattactatcgacgagcaatttatgtggggtcctgcacttctcttttcccct
gtgttgtaccaaggagagacctctgtttctgcttacttccctgatgcaagatggtattgt
agccacctttttatatttttattgacttttgctacagcatttgactaa

DBGET integrated database retrieval system