KEGG   Ciona intestinalis (sea squirt): 100179624Help
Entry
100179624         CDS       T01056                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00310  Lysine degradation
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100179624
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cin03036]
    100179624
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     100179624
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     100179624
Chromosome and associated proteins [BR:cin03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100179624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF3336
Motif
Other DBs
NCBI-GeneID: 100179624
NCBI-ProteinID: XP_002128556
Ensembl: ENSCING00000006541
UniProt: F6RQ08
LinkDB All DBs
Position
9
AA seq 430 aa AA seqDB search
MDVNVELFTSEKSGRGLKAKRNLNPGSTVLSSEPYAYLLSKKQKGVYCDFCFKKQDGLLQ
CSGCKYMKYCNRNCQKMAWNEHHKAECPALKNVMPKRPPDFVILLGRLLWNMQQYSSAKL
PEKNSILDLESNYNKLSQNQKEALMNFLVILHTFWSPKPLPPQVTDNKMLLELCARIKNN
SFAICNEELQSDVGTGVYLNCSFINHSCEPNCVAEFNMRTLKIRAVKNITAGEEVLISYV
DLFATSFERQRELMSIYHFQCTCHSCNAKTDDDQMMQDFDGKITESKLSSVKDMLSQMEE
LRKQCDYQKIKDLVEGCVKRKILPHENIYMAKVLDFGMDACIELGVLTQAFEFGSMALFS
YKLYLHANHPMLGIQLMKLGKILLHEEKNQDAMQFLREAFKILTITHSPNSSVLTELQNL
LGQCLAEMQN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaatgtggaacttttcacttctgaaaagagcggacgcggtctaaaagcaaag
cgtaatttaaacccaggttctactgttctttcatccgagccatatgcatatttgctatcg
aaaaagcaaaaaggcgtttattgcgatttttgtttcaaaaagcaagatggtctgttgcaa
tgttctggatgcaaatatatgaaatactgcaacagaaactgccagaaaatggcctggaat
gaacaccacaaagcagagtgccccgcactgaaaaacgtaatgccaaaaagaccaccagat
tttgtcattttacttggaaggttgctatggaatatgcagcagtacagcagtgccaaatta
ccagagaaaaattcgattttggatttagagtcaaattataataaattgtcgcaaaaccaa
aaagaggccttgatgaatttccttgttattttacatacattttggagcccaaaacctctt
ccacctcaagttaccgataacaaaatgctgttggaattatgtgctagaattaaaaataac
agttttgctatatgcaatgaagagctgcagtcggatgttggcactggcgtgtatctcaat
tgcagcttcataaaccatagttgtgagccaaattgtgttgcagagtttaacatgcggaca
ttgaaaataagggcagtgaaaaatataactgcgggggaagaagtcctgataagttatgtc
gatttgtttgctactagctttgaaagacaacgagaactaatgagtatttaccattttcaa
tgcacttgtcattcttgcaatgctaaaactgatgatgatcaaatgatgcaggactttgat
ggaaaaataacagaatcaaaactatcttctgtaaaagacatgttgagtcaaatggaggag
ttaagaaaacaatgtgattatcagaaaataaaagaccttgtggagggttgtgtaaaaagg
aaaatactgccacatgagaatatatacatggcaaaagttttggattttggcatggatgct
tgcattgaactaggtgttttgacacaggcatttgagtttggttccatggctttatttagc
tacaaattatatttacatgcaaaccatcctatgctgggcatacaacttatgaaactcgga
aaaattttactccatgaggaaaaaaatcaagacgctatgcaatttttgcgtgaagcattt
aaaattctcactataacacattcgccaaacagctctgttttaacggagctacaaaattta
ctgggccaatgtttagcagaaatgcaaaactaa

DBGET integrated database retrieval system