KEGG   Ciona intestinalis (sea squirt): 100180568Help
Entry
100180568         CDS       T01056                                 

Definition
(RefSeq) ATP-binding cassette sub-family G member 2
  KO
K05681  ATP-binding cassette, subfamily G (WHITE), member 2
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cin00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100180568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cin02000]
    100180568
   04147 Exosome [BR:cin04147]
    100180568
   04090 CD molecules [BR:cin04090]
    100180568
Transporters [BR:cin02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    100180568
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100180568
CD molecules [BR:cin04090]
 Proteins
  100180568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran AAA_21 SMC_N AAA_23 RsgA_GTPase AAA_29 cobW AAA_16 ABC2_membrane_3 AAA_18 T2SSE AAA_30 AAA_22 AAA_33 DUF87
Motif
Other DBs
NCBI-GeneID: 100180568
NCBI-ProteinID: XP_002125421
UniProt: A0A1W2W6P5
LinkDB All DBs
Position
8
AA seq 645 aa AA seqDB search
MLERQRNGGVKNEAYEDSDSCRVTIDTMQKQEIRGPVLSFHDISYNVDTGRGVGGNKGQK
NILNNLSGVMKPGLNAILGPTGSGKTTLLDVLAGRKNQTGLTGSVLLNNQTLPSNFKCLS
GYVIQNDIVTPTLTVRENLWFSAHLRLPQTVSNQSKQERIDQILVDLNLTSCADTKIGNE
MIRGVSGGEKKRASIGMELITAPTVLFLDEPTTGLDASTANAVMFLLKQLSQKGCTVIFS
IHQPRYSIFKHFDTLTLLGEGHMVYQGPKQQVLPYFESIGYTREEHNNPADFLLDVINSD
SPTFKSNGNGSNVKSEGRKSSLSEHLSSLYKESIQQDSYIKEKDVSEMKSTVNDTEYTTS
TMYQFMKLFQRELVGLFRSPAAIIANVTINILSGLIFGILYFNIGMSQTIGVQNRFGVLY
FMLTKAMFDNTAIADLFIKERSLFVHEYISGYYRVISYFLAKLLAVVIPLNTIGVLLTSV
IAYWMVGLKADVSSFFIFFLFCLLISLSAASIVLFYSASFSNSSVASLVTTLTFVFSLLF
NSLTINVGSMFKWVSWIKYLSISHYSFTGAAINEFSGLNFQAKCFPPNSTCPSVLGETII
QGRLSLNTSETIEWQLWQNVLALVCIFMGMLVLTYVQLTRTKLYT
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaggcagagaaacggtggagtgaaaaacgaagcttatgaagattcagattca
tgtcgagttactatagatacaatgcagaaacaagaaattagaggccctgtcttaagtttc
catgatatttcatacaatgtggatactggtaggggtgttggtggaaataaaggacagaaa
aatattttgaataatttgagtggagtaatgaaacctggtcttaatgcaatattgggaccc
actggcagcggcaagactacgctgttagacgtgttggctggaagaaaaaatcagactgga
ttaacaggttctgtacttttgaataaccaaactctgccttccaatttcaagtgcttaagt
ggatatgtaatacagaatgatattgtgacgccaacattgacagttcgtgaaaatctttgg
ttttctgctcatcttcgtttaccacaaacagtttcaaaccaatcaaagcaagaaagaatt
gatcaaatattagttgatcttaacctaacatcatgtgctgatactaagatcgggaacgag
atgatccgaggagtatcgggaggagagaagaagagagcatcgattgggatggagctcatc
actgctccaactgttctcttcctggatgaaccaaccacagggttggatgcttccactgct
aatgccgtcatgtttctactgaaacaattaagccaaaaaggttgcaccgtcatattttca
atccatcaacctcgttacagcatatttaaacattttgacactcttacattgcttggggag
ggacatatggtttaccaaggacctaaacaacaagtcctgccttactttgaaagcattggt
tacactcgtgaagaacataacaatccagcagactttttacttgatgttataaacagtgat
tcccctacatttaaaagtaatgggaatggtagcaatgtaaaatcagaaggtcgaaaatcc
tcattatccgaacacctttcctcactttataaagagtcaattcaacaagattcttacatt
aaagagaaagatgtgtctgaaatgaaaagcacagtaaatgatactgaatacaccacatct
actatgtaccagttcatgaaattgtttcaaagagaactagttggtttgtttcgaagtcca
gctgctattattgcaaatgtaacaatcaacatattatcgggacttattttcggaattctt
tattttaacattggtatgtcacaaacaataggagttcaaaacaggtttggtgtcttgtac
ttcatgttgacgaaggcaatgtttgacaacacagcaattgctgatttatttattaaggaa
agatcgttgtttgtccatgaatacatatcaggatactatcgagtgatctcatattttctt
gcaaagcttctggcagttgttatacctctaaacacaattggtgtattacttacctctgtc
attgcatactggatggttggtttaaaagctgatgtttcatcctttttcattttcttctta
ttttgccttttgatttctctatctgccgcttctattgttttgttttattctgcatcattc
tcaaatagctcagttgcatcattggtgaccacactcactttcgttttctcgctgcttttt
aacagtcttacaataaatgttggctcaatgttcaaatgggtttcttggattaaatatcta
agcatctcacattactcatttacaggtgctgcaatcaatgaattttctggtttaaatttc
caagcaaaatgttttccaccaaactctacatgtccctctgtattgggagaaaccattata
caaggaaggttatctcttaacacatctgaaacaatagagtggcagttatggcagaatgtt
cttgcattggtttgcatatttatggggatgctggtacttacttatgttcaactgactagg
acaaaattgtacacataa

DBGET integrated database retrieval system