KEGG   Ciona intestinalis (sea squirt): 100180899Help
Entry
100180899         CDS       T01056                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cin01002]
    100180899
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100180899
   04090 CD Molecules [BR:cin04090]
    100180899
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100180899
Peptidases [BR:cin01002]
 Metallo Peptidases
  Family M2
   100180899
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100180899
CD molecules [BR:cin04090]
 Proteins
  100180899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100180899
NCBI-ProteinID: XP_002123029
UniProt: A0A1W2W363
LinkDB All DBs
Position
Un
AA seq 1240 aa AA seqDB search
MFRYLVGHLSLLILLSGSARADLQSEAVAFTANYSTDAAEVYYNSSLAAWNYQTGISEEN
LNAMNAENVKSAAFTKMYGEQAKAEFPDTSKLEESERRQIDSIKILGTANLNEADLNQYN
DLTGGMEATYSTATVTMPDGRVLNLDPDLTALMATSRDYNELKYAWKGWYEAAGRPIRDD
YESFVTLSNKASVADGFADTGEYWRSWYEMNGQLEATVDALWAELQPLYTELHAYVRRKL
YEKYGSNYINLKAPIPAHLLGNMWAQQWGNIYDLVEPYSGKTGVDATPAMQSQGYDAMKM
FKTSEEFFVSLGLDKMTDEFWANTMFVKPTDRDVVCHASAWDFYNKVDFRIKMCTVVNME
DLITIHHEMGHIQYYQQYKDQPIPFRGGANPGFHEAVGDTLALSVSTPKHLNKIGLLDEV
EEDDEADINYLLSQAMDKIAFLPFGLMIDKWRWSVFSGDTPKAKYQEKWDQLRKDLQGIT
PPVERDGTTDFDPGAKYHVPANTPYIRYFVSFVVQFQFYQSMCNASGHQGPLYKCDFYQS
KEAGAKLQKMLELGSSKPWQFAMNEITGSADMSTLALQEYFSPLTAWLKQKNLENGDTPG
WTDMDWRPMGYKLEDSVVGFLDSYNSSAEDVYFKAVSAEWEYNTNINDQTQAASGVASQE
QAQFNAEQAVLAKQYDPLDISDPTNTRLIEKLSVVGTGALPDADLQALTEVNSKMQTKYS
TAKACGVGDRPQSECIPLDPDLTAIMATSRNYNELRDAWLTWRDASGSTMRDDYISYIDL
ENEAAVLNNYHDMGEYWRADYETPDIEEQLEKVWQEMLPLYEELHAYTRRKLYNYYGGEV
INLKGPIPAHLLGNMWAQSWLDIYNLVEPYSGKSRPDATPGLQQKGWNAEKMFHVADDFF
GDMGLMKCPDEFWSKTMFTKPEGREVVCHASAWDFYNRKDFRIKMCTEINQNDFVTIHHE
LGHIQYYMQYQHLPVTFRDGANPGFHEAVGDTLALSVGTLEHMYKLGLIDEPTDDLESDI
NYLMSVALDKLAFIPFGYLMDKWRWDVFSGRISKANMNQGWWDYRVKYQGVAPPQSRDET
DFDPGAKFHIANNVPYIRYFVSTVVQFQFYESLCKEANHTGDLFKCDFNGTKAAGDKLGA
MLRLGSSVKWEDALEQITGSREMTSASLVNYFTPLLNFLKEENKKNNDVVGWPDYSWEPP
TNTLSGNGKVLLDNAGSTAKPSSLTFIAFVFFLITRVLLE
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggtacctggtcggtcatttgtctctgctaatcttgttatcagggtcagcaagg
gcggatttacagagtgaagctgtggcattcactgctaattattccacagacgctgctgag
gtttattacaattcaagccttgcagcgtggaattaccaaacgggtatttcggaggaaaac
ttgaatgccatgaatgccgaaaacgttaaatctgccgcattcaccaaaatgtacggcgaa
caagcaaaagcagaatttccagacacttcaaaattggaggaaagtgaacggcgacagata
gacagcatcaaaattcttgggacggcaaatttaaacgaggctgacttaaaccagtacaat
gatttaactggaggtatggaagcaacttacagcacagcaacagttacaatgcccgacgga
cgtgttctaaacttagatccagatttgactgcattgatggctacatcacgtgattacaat
gagttgaaatacgcgtggaaaggatggtacgaagctgctggtcgaccaatcagagacgac
tatgaaagtttcgtaacgttgtctaataaagcaagtgtcgcagatggattcgctgacacg
ggagaatactggagatcttggtatgaaatgaatggtcagttagaagcaaccgtggatgcg
ctgtgggccgagctacaaccgctgtacacggagcttcacgcttacgttagaaggaaactg
tatgaaaagtatggatcaaactatatcaaccttaaagctccaatacctgcgcatttactt
ggtaacatgtgggcacaacaatgggggaatatatatgatcttgttgaaccttattcgggt
aaaacaggagttgatgcaacacctgccatgcagagccagggatacgacgcaatgaaaatg
tttaaaacatcggaagagttttttgtttcattgggattggataaaatgaccgatgaattt
tgggcaaacacaatgtttgtaaaacccactgaccgagatgtagtctgtcacgcatctgct
tgggacttttacaataaagttgatttcagaataaagatgtgtactgtggtgaacatggaa
gaccttataaccatacaccatgagatgggtcatattcaatattatcaacaatataaagat
caaccaataccatttagaggaggagcgaatccaggatttcatgaagcggttggtgacacg
ctagctttgtctgtgagcacgcccaaacatttaaacaaaattggacttctggatgaagta
gaagaagatgatgaagccgatattaattatcttctcagccaagccatggacaagattgct
tttctaccttttggtttgatgattgacaaatggcgatggagtgttttttctggtgatacc
ccgaaagctaaataccaggaaaagtgggatcagttgagaaaagatttgcaaggaataact
ccacctgttgaaagagatggaacaacggactttgaccctggagcaaaatatcacgttcct
gccaatactccgtacatcaggtactttgtgagtttcgttgttcagttccagttctaccaa
tccatgtgcaatgcaagtggccaccaagggcctttatataagtgtgacttttaccaatca
aaagaagctggagcaaaactacagaaaatgttggaacttggctccagcaaaccatggcag
tttgcaatgaacgagatcactggttctgcggacatgagcaccctcgcacttcaagaatat
ttcagtccattgacagcttggttaaagcaaaagaacttggaaaacggggacacacctggg
tggacggacatggattggagaccaatgggttacaagttggaagattctgttgttggtttc
ttggatagttacaactcatctgctgaagatgtttattttaaagcagtgtctgctgaatgg
gaatataacacaaatataaatgatcaaacacaagcagcaagtggtgtggcaagccaggag
caagcgcagttcaacgcagaacaagctgtattagccaagcaatacgacccacttgatata
agtgatccaacaaatacgaggttaattgaaaaacttagcgttgttggcacgggtgcttta
cctgatgcagatctacaagctttaaccgaagtaaactcgaagatgcaaacgaaatacagc
acagcaaaagcgtgtggggttggtgacagacctcaatcagaatgcattcctttagatcct
gatcttacagctatcatggccacatcaaggaattataacgaacttcgagacgcgtggtta
acatggcgcgatgcaagtggatcaacgatgcgcgatgattatatttcatatatagatcta
gagaatgaagcagccgtgttgaacaattatcatgatatgggtgaatattggagggctgat
tatgaaacaccagatattgaagaacagttggaaaaagtttggcaggaaatgttgccgctg
tatgaggagttacacgcttatacacgaagaaagttgtacaactactatggtggtgaagtt
atcaatttgaaaggtcccattcctgcacatttgttgggaaacatgtgggcacaaagttgg
cttgacatatacaatctcgtggagccttatagtggtaaatcacgacctgatgccacacct
ggtttgcaacaaaagggttggaatgccgagaaaatgttccatgttgccgatgacttcttt
ggtgacatggggttgatgaaatgtcctgatgagttttggagcaaaacaatgtttactaaa
cctgagggtcgtgaagtggtgtgccacgcttctgcttgggacttttataacagaaaagat
ttcagaatcaaaatgtgcactgaaattaatcaaaatgactttgtaacaatccaccatgag
ttaggacacatccaatattacatgcaataccaacatctgcccgtgacgttcagggacgga
gcaaatcctggtttccacgaagcagttggtgatactctggcactttctgttggaacactc
gagcatatgtacaagcttggtttaattgatgaaccaacggatgatctggaaagcgatatc
aactatttaatgagtgtcgcgttagataaactagcattcataccatttggttaccttatg
gataaatggagatgggacgtatttagtggaaggataagcaaagcaaacatgaaccagggt
tggtgggattacagggtcaagtatcaaggtgttgctcctcctcaatcaagagatgaaacc
gattttgatcctggcgcgaagttccacatcgctaataatgtcccatacatcaggtacttt
gtaagcacagttgtgcagttccagttctatgagtctctatgtaaggaagccaaccacact
ggggatctgtttaaatgtgatttcaacggaaccaaagcagccggagataaattaggtgcg
atgctgcgtcttggatcaagcgtaaaatgggaggatgctttggaacaaatcactggctcc
agggaaatgacatctgcatcgcttgttaattactttacaccactcttgaacttccttaaa
gaggaaaacaagaaaaataacgacgtagttggttggccagattactcgtgggaacccccg
actaacaccttgagtgggaacgggaaggtcttactggataatgcgggctccacagccaag
ccaagctctctcacgtttattgcttttgtgtttttcttgatcacacgagtattattggag
taa

DBGET integrated database retrieval system