KEGG   Ciona intestinalis (sea squirt): 100181830Help
Entry
100181830         CDS       T01056                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00020  Citrate cycle (TCA cycle)
cin00190  Oxidative phosphorylation
cin01100  Metabolic pathways
cin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100181830
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100181830
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100181830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer2 Fer4_18
Motif
Other DBs
NCBI-GeneID: 100181830
NCBI-ProteinID: XP_002127020
Ensembl: ENSCING00000006854
UniProt: F6ZX12
LinkDB All DBs
Position
7
AA seq 292 aa AA seqDB search
MSSGLRISRTVLRSSSPVLSLLTTQTLRCSATAAAQTTEQNQRLKTFSIYRWNPEAEGDM
KLPVMHKYQVDLNDCGPMVLDALIKIKNEQDPTLTFRRSCREGICGSCAMNIGGTNTLAC
LARIDTNLSKKTKIYPLPHMYVVKDLVPDMNNFYAQYRSIEPFLKQKDASKLGKENFQSV
ADRQKLDGLYECILCACCSTSCPSYWWSSDKYLGPAVLMQAYRWIIDSRDEYQKERLDRM
NDPFSLYKCHTIMNCTKACPKGLNPGLAIAELKKMLASHNSAEVASPKPAAQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggacttcgaatttctcgtacagtgttgcgaagttcgtctccagtactgtca
cttttaaccactcagactctgcgttgttcagcaacagctgctgcccaaacaaccgaacaa
aatcagcgtttgaaaacattttcaatttaccgatggaatcctgaagcagagggtgacatg
aaactccctgtcatgcacaagtatcaagtggatttaaatgattgtggtccaatggttctt
gatgctctgatcaaaataaagaacgaacaagatccaactttgaccttccgtagatcatgc
agagagggaatctgtggttcatgtgcaatgaacattggtggtactaacaccctggcttgc
ctagcgagaattgataccaacttgtcaaagaaaaccaagatatatccattgcctcatatg
tatgtggtgaaagaccttgtaccagatatgaacaacttctatgcacaatatcgctctatt
gaaccgttcctgaagcagaaagatgcaagtaaacttggaaaagaaaactttcaatctgta
gcagacaggcaaaagttagatggtttatacgaatgcatcctctgtgcttgttgttccact
tcatgtccaagttattggtggagttcagacaaataccttggccctgcagttttaatgcaa
gcatacaggtggattatagatagcagagatgaataccagaaagagagactggacagaatg
aatgatcctttttcactttacaaatgccatactataatgaactgtacgaaagcatgtcca
aagggtttaaatcctggtttggcaattgctgaattaaagaagatgcttgcaagccataat
tcagcagaggtggcctcaccaaaaccagcagcgcagtga

DBGET integrated database retrieval system