KEGG   Ciona intestinalis (sea squirt): 100182870Help
Entry
100182870         CDS       T01056                                 

Definition
(RefSeq) prominin-1-like isoform X1
  KO
K06532  prominin 1
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100182870
   04090 CD molecules [BR:cin04090]
    100182870
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100182870
CD molecules [BR:cin04090]
 Proteins
  100182870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prominin Baculo_PEP_C Prefoldin
Motif
Other DBs
NCBI-GeneID: 100182870
NCBI-ProteinID: XP_026694420
UniProt: A0A3Q0K5V9
LinkDB All DBs
Position
1
AA seq 864 aa AA seqDB search
MSTNLTYPDLPENVYSAVTVDLSIVSLQHLFVMTTSFINLVFRPFSAIEEFIYSIATSGT
TNFLGDLLKNWQTSLPGRLFVTYKLASFEAGFMACFVAGCLFIILVPLVGAIMCCCRTCC
DNCGGEMIQSKSRVQSKWRYCFFASLLIITVFIMIPCVFVFLTNEWVTQVVKVIPDKTVK
VFNDFSSYLELIPTQFNFIVNQYYTLDQGLSTDIQNLGTSVGVPIRDTFIALATPALTLL
TGISNDADKSLTELVSIQQSTDVLINGSNNLDSQLSSLRSRMASSLNTTECRGDMYCRGV
LISIDSLTTGGDFSALQSVQAQITEINDTLTQYDINAEINKVMKQLNDIPELVTNGSANV
TKNMLSTLATINETMSKAISQLPLSSLDPLKQEMENINSTIYSIAYDYSTKYDIYRYAAG
IVLGSIVALICALYLLGMLCGGCGFKSDRNPADRSTLSNCGGISIMAGVGVSFIFGWILM
LLVTLTFTVGGHGERYVCQNLEYPYEGIKFLDDVLWKTYGSLLGIKLYTDSYVPLDFSGV
LTACEGNSSIYTALQLEELFNVTEFIQSATENLNSFKTQLSDLTVDLSSLKAYTPEIANA
LNALKQTGLDGINFDSYLNATAQGITTVNFTFYAQFLNNSADNMTVPGATAPILNLATEI
RKFSYEVTLIQTMYVDPLTPALNTLTTDINSLQKTATGLNASIDETAAALQTLDSVIQTN
GSALVSVEINKYADTLILSVNQYAAWFLDQVTNHFGQCYPVVLVYNQFVSILCSYFMDIL
NGLWFCLGWITFFLIPGAIFGMKLAKYYRRLQDMESYNDNHWNDMEMDAFNRSNNNGQQQ
QKSSGKFSFLSPQRSAKIHPGEYY
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgaatttaacctaccctgacctgccggagaatgtgtacagtgcggtaaccgtg
gacctaagcattgtttcattgcaacatctttttgtcatgaccacttcgtttattaatctg
gtgtttcgtccttttagtgctattgaagagttcatatactcgatagctacttccggaacc
actaatttcttgggagacttactgaagaattggcaaacatctttgccaggcagactgttt
gtcacatataagcttgcatcatttgaagctgggttcatggcttgtttcgtcgctgggtgt
ttgttcatcatcctcgttccattagttggcgctataatgtgttgttgccgaacatgctgt
gacaactgtggtggggaaatgatccaatcaaaaagtcgagtgcagagtaaatggagatac
tgtttctttgcgtcccttctcataatcactgtgtttattatgataccgtgtgtgtttgtc
ttcctaaccaatgaatgggtcacacaagttgtgaaagtaattcccgacaaaacagtcaaa
gtttttaacgactttagcagttatttggaactcattcctactcagttcaactttatcgtt
aaccaatattacacacttgatcaaggtctttcaacagacatacaaaatttgggtacctca
gttggcgttccaatcagagatactttcattgcacttgccactcctgcactcactctactt
actggaatatccaatgacgctgataaaagtttgacagaacttgtcagcatccaacagtca
accgacgttctcataaatggctccaacaaccttgacagccaacttagttctttgagatca
agaatggcatcctcattaaacacaactgagtgtaggggggatatgtactgtcgtggcgtg
cttatatctattgattccttaaccactggtggtgacttctctgcactccagagcgtgcag
gcgcagattaccgaaataaatgacacgttgacgcaatatgacatcaatgctgaaattaat
aaagttatgaaacaacttaatgatattccagaactcgtaaccaatggcagtgctaatgtt
acaaaaaatatgttgagtacattagcgacaatcaatgaaaccatgagtaaagccataagt
cagttgcccctctcatcactggaccctttaaaacaagaaatggaaaatattaactcaacg
atatatagtattgcttatgactatagtacaaaatatgacatatacaggtatgctgctggg
atagtcctcggttctattgtggctttaatttgcgctctgtacctccttgggatgttatgt
gggggttgtggcttcaagtcagacagaaacccagccgacagatccactttgtcaaactgt
ggtggcatctcaattatggctggtgtgggggtatcctttatatttggttggattctgatg
ttgttggtgactctcaccttcacagtgggtgggcatggggagagatatgtttgccagaac
cttgagtatccttatgaaggaattaagtttttggacgatgttttatggaaaacatatggg
agtcttcttggtatcaaactatatactgattcatacgtaccacttgactttagtggtgta
ttaactgcatgtgaaggaaattcttcaatctacaccgctctccaacttgaagaattattt
aatgtcaccgagtttattcagagcgcaacagaaaatctgaacagtttcaaaacccaactt
tctgatttaacagttgacctctcctctttaaaagcttacactcctgagatagcgaatgct
cttaatgctttgaaacagacaggtcttgatgggatcaattttgattcttatttaaatgca
acagcgcaaggcattaccacagtcaactttacattctatgctcaatttctaaacaactct
gcagacaacatgacagtgccaggtgcaactgccccaatacttaatctagcaactgaaatt
cgcaagttctcctatgaagtaacattgatacaaaccatgtacgttgatcctctcacacct
gcccttaatacacttaccacggatataaactccctgcagaaaactgctactggattgaat
gcatccatagatgagacagcagctgcactgcagacattagacagtgtcatacaaactaat
ggatcagctttggtttcagtagaaatcaataaatatgctgacactctcattttgagtgtc
aaccaatatgctgcttggtttcttgatcaggttaccaatcactttggacaatgttatccc
gtcgtgttggtttataatcagtttgtgtccatactctgcagttatttcatggatatcctg
aatggtctctggttctgccttggttggattactttcttcttgattcctggtgccatcttt
ggaatgaaacttgccaaatattacagacggcttcaagacatggagagctataatgataac
cattggaatgatatggagatggatgcattcaacagaagcaacaataacggacagcaacag
cagaagtcttcaggaaagttcagttttctatctccacaaagatctgctaaaattcacccc
ggggaatattactga

DBGET integrated database retrieval system