KEGG   Ciona intestinalis (sea squirt): 100183000Help
Entry
100183000         CDS       T01056                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00020  Citrate cycle (TCA cycle)
cin00190  Oxidative phosphorylation
cin01100  Metabolic pathways
cin01200  Carbon metabolism
Module
cin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cin_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100183000
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100183000
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100183000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100183000
NCBI-ProteinID: XP_009859687
Ensembl: ENSCING00000004289 ENSCING00000020844
UniProt: A0A1W3JEZ2
LinkDB All DBs
Position
9
AA seq 665 aa AA seqDB search
MASLLKFPISPVSRCLIQNSVGVKAAGCSSTHRHLHLASRQAQVKKSTKISTSYPVVDHE
YDAVVVGAGGAGLRAAFGLSEAGFKTACVTKLFPTRSHTVAAQGGINAALGNMEQDNWKW
HMYDTVKGSDWLGDQDAIHYMTKEAPAAVIELENYGMPFSRTNEGTIYQRAFGGQSLDYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLAYNTDYFIEYFAMDLLMEEGECRGVIAMSLED
GTIHRIKAKNTVLATGGYGRAYFSCTSAHTCTGDGSAMVTRAGLPNQDMEFVQFHPTGIY
GAGCLITEGCRGEGGYLVNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGCGPNK
DHVYLQLHHLPPQQLATRLPGISETAQIFAGVDVTREPIPVLPTVHYNMGGVPTNFKGQV
IYYDDKSSSDVVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEENKPGE
DIGEISENAGEASIENLDKLRYADGATPTAELRNKMQQVMQTNAAVFRTGPVLKEGVQKI
QDIYDEMDDLKLSDRGLIWNSDLIETLELQNLLLNAAQTVVAAERREESRGAHAREDFKD
RCDEFDYSKPLQGQEALPQSKHWRKHTLSNMNVQTGKVELNYRPVIDSTLDQKECKTVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctactaaaatttccaatttcaccagtttcaagatgtttgatacagaattca
gttggtgtaaaagctgctggctgctcctcaacacacagacacctccatctggctagcaga
caagcccaggttaaaaaatcgacaaaaatatcgacttcatatcctgtggtggaccatgag
tatgatgctgtagtggttggagcagggggtgcgggtttgagggccgcatttggtttatca
gaggctggattcaaaactgcttgtgtgacgaaattgttcccaacaaggtctcatactgta
gctgctcagggaggaataaacgcagctctcggtaacatggaacaagacaattggaaatgg
cacatgtatgacacagtaaaagggtctgattggttgggagaccaagatgcgattcattat
atgacaaaagaagctccagctgctgtaatagagcttgaaaattacggaatgccgttcagt
cgaactaatgaaggaacgatttaccagcgagcgtttggtggacaaagtttggattatggt
aaaggtggtcaagctcatagatgttgttgtgtggctgataggacaggtcattcgttacta
cacacactttatggcaggtcgctggcatacaacaccgattatttcattgaatattttgcg
atggatcttttaatggaggaaggcgagtgtaggggagtgatcgcaatgagtttggaagac
gggacaattcatcgcatcaaagcaaagaacacagtgcttgctacaggaggttacgggcgt
gcttacttcagctgtacatcagcacacacatgtaccggggatggatcagccatggtgacg
agggctggactgcccaaccaagacatggagtttgtacagttccacccaacaggtatatat
ggagctggatgcctcatcacggaaggctgcagaggtgaaggaggatatcttgtcaactca
gaaggtgaaaggttcatggaaagatacgcaccaactgctaaagatcttgcatcacgtgat
gttgtgtctcgatccatgacgattgaaatcagggaaggcagaggttgtggtcctaacaag
gaccatgtatacctccaacttcaccatctacctccacaacaacttgctacgagacttccc
gggatttcagaaaccgcacaaatctttgctggtgttgatgtaacccgtgaacccattcct
gtgctaccaactgtgcattacaacatgggtggggttcctaccaactttaaagggcaggta
atttattatgatgataaatcgtccagtgacgtggtggtgccgggtttatatgcgtgtggt
gaagctgcgtgcgccagcgtgcatggggcaaacaggctcggtgcaaactccctgcttgac
ttggttgtgtttggacgagcgtgtgcgcttactatagctgaggagaataaaccaggagaa
gatatcggagaaatcagtgagaatgctggtgaagcctccattgaaaacctggataaactc
cgctacgcagatggagcaacgccaaccgctgaacttcgcaacaaaatgcaacaagtgatg
caaaccaacgctgctgtgtttagaaccggacccgtgttaaaggaaggggtgcagaaaata
caagatatctatgatgagatggatgatcttaagctttctgatcgtggtttaatctggaat
tccgatttaatcgaaacactggagttgcaaaacttgctactgaacgctgcacagactgtg
gtggctgctgagaggagagaggaaagtagaggcgcgcacgcaagagaagatttcaaggac
cgatgtgatgagtttgattattcgaaaccactacaaggccaggaagctttaccacaatcc
aaacattggcgtaaacacacattatcaaacatgaatgttcaaactgggaaggttgagctg
aattatcgaccagttatcgattcaacacttgaccaaaaagaatgcaaaactgttcctcca
gcaattcgctcttattaa

DBGET integrated database retrieval system