KEGG   Ciona intestinalis (sea squirt): 100187282Help
Entry
100187282         CDS       T01056                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00052  Galactose metabolism
cin00500  Starch and sucrose metabolism
cin01100  Metabolic pathways
cin04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100187282
   00500 Starch and sucrose metabolism
    100187282
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100187282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100187282
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100187282
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100187282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100187282
NCBI-ProteinID: XP_026693555
Ensembl: ENSCING00000003924
UniProt: A0A1W3JMF7
LinkDB All DBs
Position
14
AA seq 880 aa AA seqDB search
MQFLSLYLSLILLRVCIIEAIQCSIENQDRVDCYPETIPAVKEHCEQRGCCYNSNPNVND
NVPWCFFPTDYKAYKLSDYKTTPHGFQGDLTLTSGASHHFVDEIQQLKLLVYLETETRLH
FKIVDANKPRYEVPIQTPALQKAAENTAYKVDVQNNRFGLIVTRKDTGVVILNTTIAPLI
YSDQFLQMSSALPTNDIYGLGERHGGALVSTNWNRLLFWARDQRPQENENLYGDHAFYMG
IENDGKAHGVFLLNSNAKEIELQPSPALTWRTIGGILDFYVFLGPTPEEVVQQYTQVIGR
TFMPPYWSLGFHLCRWGYGSSNNTWDIVKRMREAKIPQDVQWNDIDYMSKRLDFTYDKTT
FDTLPQMVEDLHENGQHYIMIIDPGISNKQPTGTYPAYKQGIELDVFIKDPRTNAPISGE
VWPGSTVYPDYTHPNINSYWKNQLSGYEDKINFDGVWVDMNEPSNFVTGSTTGCPNNQYE
DPPYVPHVTGGKLQSRTLCSSSKHYNETIHYNVHSLTGLLEMKATSEVMASIRKKRPFVI
SRSTFPSAGMYGGHWSGDITSTWPDLRQSIASVINFNMFGIPMVGADICGFSGSTNEELC
IRWMQLGAFYPFSRNHNMKLTRGQAPVDFSTPVQVPMRNALLKRYLFLPYLYTLFYSSHI
NGTTVARGLMIEFPEDHTARKIDEQFMWGSGLLISPCLYVSSSRVNAYFPRGLWYDCTTE
NFGNKINSQGQYETLSAPLNGSIPLHIRGGNIIPAQYPELNTVKSRKQPFILFVAPDNTG
KACGQLYWDDGETLLGDGSIKHVAIDFVLLDNTLSSYASNFNYTESMMVSDISIFGISTK
PKSVTFNKKEIVKTEIVNGNTLRVEVSADLKENFELKWVL
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttctttctttatatttatctctgattttgttacgggtctgcatcattgaagca
atacaatgtagcattgaaaaccaagacagggtcgactgttatcccgaaactattccagct
gtcaaagaacactgtgagcaaagaggatgttgttataactcgaatccgaatgtaaatgat
aatgtaccatggtgctttttccctacagactacaaggcctataagctgtcagattacaaa
acgacacctcatggttttcaaggcgaccttacattaacgtctggtgcatctcatcatttt
gttgatgaaattcagcagctgaaactattggtgtatctggagacagaaacccggcttcat
tttaagatcgttgatgcaaataaaccaagatatgaagttccaatccagacgcctgcttta
caaaaagctgcagaaaatacagcatacaaagttgatgtacagaataaccgttttgggtta
atagttacaaggaaagatactggtgttgtcattttaaacacaactattgctccattgatt
tattcagaccagtttttacagatgtccagtgccctgcccacaaatgacatatatggcttg
ggagaacggcacggcggtgctttggtcagcacaaattggaacagattgttgttctgggca
cgagatcagcgcccacaagaaaacgagaacttatatggcgaccatgcattttatatgggc
attgaaaatgatggtaaagcgcatggtgtcttcttattgaacagtaatgctaaggaaata
gagttacagccttcaccagctctaacatggagaactattggaggaattcttgatttctat
gtgtttttgggacccacacccgaagaagttgtgcaacagtatactcaagtaattgggcgg
acatttatgcccccatattggtccctaggcttccacttatgtagatggggatatgggagt
tccaacaatacttgggatatagtgaagcgtatgcgagaagcaaaaattccccaggatgtg
cagtggaatgatattgattatatgtccaagcgcttggatttcacatacgacaaaaccact
ttcgatactctcccacaaatggtggaggaccttcatgaaaacgggcagcattatatcatg
attatagaccctggtatatctaataaacaacctactgggacttatccagcttataaacaa
gggatagaattagatgttttcattaaggatccgcggacaaatgctccaataagtggagaa
gtttggcctggctcaactgtctatccagactacactcatcctaatattaattcttactgg
aaaaatcagttatctggttatgaagacaagataaacttcgatggtgtttgggttgatatg
aatgaaccttcaaattttgtcactggatcaacaactggttgtccaaataaccagtatgag
gacccgccctatgttccacatgtgactggtgggaaactgcaatctaggaccttgtgttca
tcgtctaagcattataatgaaacaatccactataatgtacacagccttactggacttttg
gaaatgaaagccacaagtgaggtaatggcatccatacggaagaaaagaccatttgtaata
tcaaggtctacttttccaagtgctggtatgtatggcgggcattggagcggtgacattaca
agtacctggcctgatctaaggcagtcaattgccagtgttataaattttaatatgtttggt
attccaatggtgggagcagacatttgtggattttctggcagtactaatgaagagctgtgt
attagatggatgcaacttggggcattttatccatttagtagaaatcataacatgaaatta
acaagggggcaagcaccagtggatttttcaacaccagtgcaagtccctatgagaaatgca
ctgctgaagaggtatctgttccttccatacctgtacaccttgttttattcatcccatatt
aatggtacaactgtggcaagaggtttgatgatagagttcccagaggaccatacagcaaga
aaaattgatgagcagtttatgtggggcagtgggcttttaatatctccgtgtttatatgtt
tcttctagccgtgttaatgcttactttccacgcggtttgtggtatgattgcacgactgaa
aactttggcaataagatcaactcgcaaggacaatatgagacactctctgctcctttgaat
ggctcaatacctcttcatattagaggtgggaacataataccagctcagtatccagaattg
aacacagtgaagagcagaaaacaaccctttatcttatttgtggctccagataacacagga
aaagcttgtgggcagctgtactgggatgatggagagacacttttgggtgatggttctatc
aagcatgttgccattgattttgttttattggacaataccttgtcctcgtatgcttccaat
tttaactacactgaaagcatgatggtttcagatatttctatatttggtattagcactaaa
cctaaatctgttacatttaacaaaaaagaaatagtgaaaacggaaatagtaaacggtaat
acactaagagttgaggtttcagctgatttaaaagaaaactttgagcttaagtgggttttg
tga

DBGET integrated database retrieval system