KEGG   Ciona intestinalis (sea squirt): 778778
Entry
778778            CDS       T01056                                 

Gene name
tgfbr-iib
Definition
(RefSeq) transforming growth factor beta receptor precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04068  FoxO signaling pathway
cin04144  Endocytosis
cin04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    778778 (tgfbr-iib)
   04068 FoxO signaling pathway
    778778 (tgfbr-iib)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    778778 (tgfbr-iib)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    778778 (tgfbr-iib)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     778778 (tgfbr-iib)
Protein kinases [BR:cin01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   778778 (tgfbr-iib)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Adeno_E3_CR2 Syndecan
Other DBs
NCBI-GeneID: 778778
NCBI-ProteinID: NP_001071836
Ensembl: ENSCING00000000198
UniProt: Q4H2P8
LinkDB
AA seq 567 aa
MKCLMLISLLSYLHTGSSIHCRQCSAEIDANDCNSTSCTIPCPTVDCSCLGLCYTNVILN
FSGKHSVQAACIQQLCPTRASYLNLYTKRQIEGYCDVSKGVVTCECASDDCNHMISFEPI
TIDDEDIIIEDKYDLSSIIVGVLVGFLLLCLLVAVVWYSVGRYRRLKDEEFESKLTSGSR
LSSDDASLIDGWDDSGKHSYSAYRYSSSVATQYSRGSRGNVLNHNDQHLPIELQKIIGKG
RFAEVWKANLQQDASPPQVVSVKVFRLHNYGAWRQEKDMLTESWMRHENIIEFYASEQHT
VRGRLQYWLITSYYQEKSLADFLGSNILDWDQFCDMATSIAKGLSYLHAERDDVGRPKIP
IAHRDVKSCNILVKDGRRECVLADFGLSLKLDPKLSRDELANAGQVGTSRYMAPELLERL
VNLTDIEMFKRVDVYAMALVLWEMANRCETSEGMASPYKPPFGDKINDRPTKDQMLLLVC
KERQLPSIPEKWKKHQGLSEFVDTILNETWEYDAEARITASCVLERFKVLRHHGDVIGSD
GSDVEDKIRVKAKNESNRISEVISTVV
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaagtgtttaatgttaatatccttgctgtcatatttacacaccggttcatccatacat
tgtcggcaatgcagcgctgaaatagatgccaacgattgcaattcaacatcatgtacaata
ccttgtcccaccgttgattgtagctgccttggtctgtgttacaccaacgttattctaaac
ttctctggcaaacactccgtacaggcggcttgtatacaacagttatgtccaacaagagcc
agctatctaaacctctacactaagcgtcagatagaggggtattgtgacgtaagcaagggt
gttgtgacgtgtgaatgtgcctcagatgactgcaatcacatgatatcatttgaaccaatc
acaatcgatgacgaagatataataattgaagacaaatacgatttgtcgtccatcatcgtt
ggtgtcttggtaggatttctcctcctttgccttcttgtggctgtggtgtggtacagtgta
ggccggtatagaaggttaaaagatgaagaatttgaaagtaaattgacatccgggagcaga
ctatcctccgatgatgcaagtcttattgatggttgggatgatagtgggaaacatagttac
tcagcttacagatattcatcgagcgttgctacccagtatagtcgtgggtcacgtggaaac
gtactcaaccataacgaccaacatttaccgatcgaacttcaaaaaataatcggcaaagga
agattcgctgaggtttggaaagcaaatctacaacaagatgcttctcctcctcaagttgtt
tcagtgaaagtatttcgtcttcacaattatggggcgtggagacaagagaaagacatgcta
actgaaagttggatgaggcacgaaaacatcattgaattttatgcttctgagcaacacaca
gtgcgaggtcggttgcagtattggctcataacttcttactatcaagagaaaagtttagct
gactttttgggctccaatattcttgactgggatcagttttgtgacatggcaacctcaata
gctaaagggttatcatacctgcatgcggagagagatgacgtgggtcgccccaagatacca
atcgcccacagagacgtcaaaagttgtaacatccttgtgaaagatggcaggagagaatgc
gtgttggctgacttcgggctttcactcaagttggacccgaagttgagtcgtgatgaactt
gcaaacgctggccaggttggaacatcaaggtacatggctcccgagttattggaaagactg
gttaacctcacagatattgagatgtttaagcgagttgacgtttacgcgatggctttagtt
ttgtgggagatggcgaatcgttgtgaaacttcagaaggcatggcgtctccgtataaacca
ccgtttggagacaaaataaacgaccgacccaccaaagatcaaatgctgcttcttgtgtgc
aaagagcgccaactaccgagtattccggagaaatggaaaaagcaccagggtctctctgaa
ttcgttgacactatactgaacgaaacatgggaatatgacgctgaagctagaatcaccgct
agttgtgtgttggagagatttaaagtattacgtcatcatggtgacgtcatcggctctgac
ggcagtgacgtcgaggataagattcgtgtgaaagccaagaatgaatcgaacagaatatct
gaagttatttcaacagttgtgtga

DBGET integrated database retrieval system