KEGG   Ciona intestinalis (sea squirt): 778910Help
Entry
778910            CDS       T01056                                 

Definition
(RefSeq) flocculation protein FLO11 isoform X2
  KO
K09258  B-cell CLL/lymphoma protein 3
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cin03000]
    778910
   03110 Chaperones and folding catalysts [BR:cin03110]
    778910
Transcription factors [BR:cin03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    778910
Chaperones and folding catalysts [BR:cin03110]
 Other chaperones and cochaperones
  Others
   778910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3 YpzG
Motif
Other DBs
NCBI-GeneID: 778910
NCBI-ProteinID: XP_002122554
Ensembl: ENSCING00000009876
UniProt: A0A1W2W6G2
LinkDB All DBs
Position
10
AA seq 1022 aa AA seqDB search
MLSASNKHDLTPKETLFIATECHLASLQDNDGDTPLHISIVRHDTQKSLELIRLFQISRK
NIDILNRLMQTPLHLAVITSQCEVVDGLLNCAANPNVLDRFGCNVAHIAAKYNSLTCLQS
VFKYSKFPLDIEKINLEGVTALHVAVQNNSINVLKQLLQHGANIDVKDNKSGRSALIYAI
ESDNVIIVELLLEQGASVCEQTYSGDTALHIASGRAVQSIIRLLLRKGADATNRNLPNED
LHFFSPDSQLQTLQMIQAGMTNGDKQNAQLMRSMSCPTTPSEPKSMSHKSIMGKHQLENE
NQDESEISIKRNRLEVLKKEMNSQILGSSGSTISTNKTELNEDSTTDKRSIFPCIKPFGF
SSYSSILPPPPPILSSGRAAYLPPQFYKEELFRKCIQDRNVMKTSVSPFLIIPKQEKDVS
PTTSEAPIPSPTSTCNEYKIENCQSDVRGQIIPKQEGKTSPALTKPTLPIMTQYRRQAER
SMSLPGSPNPSDEALFQVAREGLAVAAMPSLSTSNSLDFITQANTVPSKIRPARQAEIKS
KTNELQKLALQGLAVAAMKEMKHEIVEKSRGTEYNEIYRRPLEHFISKDGRKSSTSFGIP
SQLQGTARQSPIEPSLLLLAQASVVQPDDASSKREDHQISVETKQSLREVILEKKKSMEP
KIPVSYTTVQTASNQTHISVEIVRPNIPTSLETNVKTENTEDVTVPLQQNESLKSASSET
SATDDSLQDIRQRLVQLNYEIQHLLSPSSDRPNPADTQQRMSTYSAEYARLCQKAKELSK
NTMVSAEPVETSAAYSPQKPVNPLYPVASIRPVHQTVFPHSPQLVLHPQLMSPQLPMPLH
YPYMVPNYSVMPGKHYPSPMYYLDYRRQVPTMPTTHLWQNPVTSVPQKSAVVATVKVLNT
HAKKSFKPGQPSSETDEAKLIKPVHQVPNFPQESYALPQSSQTVSMTTAHTTTTSILHKK
PMAAVIAIPKLEVGEDQPLNLSKKEEQPLNLQTSGWNSRMTHTLSTPSAVESASSKMQSY
YK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagcaagcaacaaacatgatttaactccgaaagaaactttgtttattgcaaca
gaatgtcatcttgcatcactccaagataatgatggtgacacgcctcttcacatatctata
gtgagacacgacacacagaaaagcttggaacttattcgattgtttcaaatttcaagaaag
aacattgatattttaaaccgattgatgcaaaccccacttcatttggcggtaattacaagc
caatgtgaggtggttgatggtttattgaactgtgcagcaaatccgaatgtattggataga
tttggttgcaatgttgctcatattgctgcaaaatacaactcattaacatgccttcaatct
gtttttaaatattcaaagtttccgttggatatcgaaaagatcaatttggaaggtgtcacg
gctttacatgttgctgtacaaaacaattcaatcaatgtgctcaagcagttgttgcaacac
ggtgccaatatagatgtgaaggacaacaaaagtggacgctcagcgcttatatatgcaatt
gaatctgacaatgttattattgtggagttattacttgagcaaggtgcaagtgtgtgtgaa
caaacatacagtggtgatacagctcttcatattgcaagtggtcgtgctgtacaaagtatt
attcgtcttttattaagaaaaggagcagacgcaacaaaccgaaatcttccaaatgaggat
cttcacttttttagtcctgattctcagcttcagacgttgcagatgatacaagctggtatg
accaatggagataaacaaaatgcacaactaatgcgaagtatgagttgtccaacaactcca
tctgaaccaaaatccatgtcacataaatcaataatgggaaaacatcaacttgaaaatgaa
aatcaagatgagagcgaaatttcaatcaagagaaacagacttgaagtccttaaaaaagaa
atgaattctcaaattcttggttcatctggttctacaatctccacgaataaaactgaatta
aacgaggattcaaccacagacaagcgttccatcttcccttgcataaaaccatttgggttt
tcaagttattcgtccatcttacctccccctccccccatcttatcatcaggaagagctgct
tatcttcccccacaattttataaagaagaattattcagaaagtgcatccaagatagaaat
gttatgaagacgagtgtttctccgttccttattattccgaagcaggaaaaagatgtttct
ccaacaacaagtgaagctccaattccatctccaacatctacatgtaatgaatataaaatt
gaaaattgtcaaagtgatgttcgtggtcagattataccaaaacaagaaggtaaaacatct
cctgcgttaactaagcccactctaccaatcatgactcaatatagaagacaagctgagcgt
tccatgtcactacctggaagtccaaacccttcagatgaagctttgttccaagttgcaagg
gaaggacttgcagttgccgcgatgccttcgttgtcaacatccaactctttagattttata
actcaagccaacactgttccatcgaaaattcgaccagctagacaagcagagataaaatca
aaaacaaatgaactgcagaaacttgcattgcaagggttagctgttgctgccatgaaagaa
atgaaacatgaaatcgttgaaaagtcacgtggcaccgagtataatgaaatctaccgacga
ccacttgaacactttatttctaaagatggaagaaaatcaagtacttcgtttggtattcct
tcacaactgcaaggcacagcaagacaatctccaattgaaccatcacttcttctccttgca
caagccagtgttgttcaaccagatgatgcatcaagcaagcgtgaagatcatcaaatatca
gttgaaacaaaacagagtcttcgagaagtcattttggaaaagaaaaagtcaatggaacca
aagattcctgtttcgtacacaacagtacaaactgcatccaaccaaacacatattagtgtt
gagattgtgagacctaatataccaacatcgcttgaaaccaatgtcaaaacagaaaacaca
gaggatgtaacggttccactacaacaaaacgaaagtttaaaatctgcttcatccgaaact
tctgcaacagatgattccttgcaagacatccgtcaacgacttgttcagttaaattatgaa
atccaacatttgttaagtccttcttctgatcgacctaaccctgcagatactcagcaaaga
atgtcgacttattctgcggaatatgcacgactttgtcagaaagcaaaggaattgagcaag
aacacgatggtttcagctgagccagtggaaacatctgcagcttattcacctcaaaaacca
gtaaatccattgtatccagttgcgtctatacgaccggttcatcagacagtgtttccccac
tcaccacagttggtgttacatcctcaacttatgagtccacaactcccaatgccattacat
tatccttatatggtaccaaactattcagtaatgccaggtaaacattacccatcacctatg
tattatcttgattatagaagacaagtgccaaccatgcctaccacccatttgtggcaaaat
cctgttacttccgtacctcaaaaatcagcagtcgttgctacagttaaagtattaaacact
cacgctaaaaaatctttcaaaccgggacaaccaagttcagaaactgatgaagcaaaacta
attaaaccagttcaccaagttcctaactttccacaagaaagctacgcacttcctcagtca
agtcaaactgtatcgatgaccacagctcataccaccacaacaagcattttacataagaag
cccatggcagctgtgattgccataccaaaactagaggtaggggaagatcaacctttgaac
ttgtccaagaaggaggaacaacccctcaatcttcaaacttctggttggaattcacggatg
acacacacattatctacaccgtctgctgttgaaagtgcttcttcgaaaatgcaatcatac
tataagtaa

DBGET integrated database retrieval system