KEGG   Ciona intestinalis (sea squirt): 778962
Entry
778962            CDS       T01056                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC778962
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    778962
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cin03000]
    778962
Transcription factors [BR:cin03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    778962
SSDB
Motif
Pfam: bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 778962
NCBI-ProteinID: XP_002123408
LinkDB
Position
13
AA seq 1023 aa
MAGNYETMFLEDNLLTENDWATCQQFPVLSTENEMNWLDFSVSSSETHSTPPQSEVTMDS
GSDSGSGSQIPLEYSNFCMGDTEFDDIINDLESPPLTPPEELESLDSFVTSQNVQNISLD
QLYPHLNNTQHDSGPQLHAASQLHNKATTRCRSGSSSSAYSSQSSTPPPPTNQSGNIFDT
AFQRQSTQQNSDEGFYEKQAVMENTKRKGVIQKRSQMIPKEESEFDKAVKDALRETNRLL
NMHRNVPEPTTETSNKIECQKAPVIDLRQVCDNVILNGDSSTTQAVSNSPVRSTMHEGSL
KRKSAKRCNRKFKKTITAESLQAVSMASYTRKMGVPPTQEQAQSTQVTTSTLSSFQIPLS
SVAEAAPMRLYVKQEPVSSLYLTTTPTQPTVCNVMSVNNSHNMVIPPSIPINLTHVTPKN
EVVLPQSFVVRSDTLHTGASSPLVNISTNGILARPKILPLTNHNQPPSDQKEGKHSQTKS
ATKPLMGSIGGPKKPIVPAAYPSFTPTVIGVNPVMGLEQRNEQLTIKDLDGRAMKRQQRM
IKNREAACQSRQRRKEYVSTLEQQMLECLDDNNKLRSMNQQLRDKVMELENENTRLRSLA
GMTTSGQRRAACILMLVLFIGFNIHPLSFLANQSISGEDTPIKFTPEDAGNFNVVKNWPA
PVESGFHGRQLLSVEEQGGKSERGVGGVRAGSETQVSSSLKKDSFWMDDLVNNYKKEHLD
KILEVLRDTSSISLQRMLRRKLKEELGIRVPMPIPRTRRISYTPTNTHEQRPPDMNSINQ
KLRFYAPKPHPSIKPAPTNVKINLCESLNKNEKQLNETESIRVSKDLDQWIAREKHNKES
NHMKNYVNKKPPDRTNKRSRRIAVSPQQRRPTKATGIALYKDKENSFNKFLDLLNRRNDT
IYVISLNQDHILLPSTVKNSSLPTKMSLVFPTAPPNETYSNNEVYQTLIQIDCEVTATDY
LQVKRELLPNSQNHVPNTVQHTTEPTNRKRKAYHAPHATNELKVRRKSKTNEEADATVTD
VDL
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggctggaaattatgaaactatgtttcttgaggataatttgttgactgaaaatgattgg
gccacctgtcaacagttcccagtcctctctactgagaatgagatgaactggttggacttt
agtgttagtagttcagaaacccattccaccccccctcaaagtgaggtcacaatggactct
gggtctgattctggcagtgggtctcaaatcccacttgaatatagtaatttctgtatgggg
gacacagagtttgatgacatcatcaatgacttggaatccccaccacttaccccaccagag
gagctagagagcctggatagttttgtgacgtcacaaaacgtacaaaatatttcactggat
caattgtatccgcatttaaacaacacacaacatgacagtggacctcaattgcatgcagcg
agccagcttcacaacaaagccaccactcggtgtcgtagtggatcatcatcctccgcttat
tcgtcacaatcatcaactccgccccctccaaccaaccaatcaggaaacatcttcgacaca
gcttttcaaagacagtcaactcaacaaaattcagatgaagggttttatgaaaaacaagct
gtaatggaaaacactaaaagaaaaggagttatacaaaaacggtcacaaatgattccaaaa
gaagagagtgagttcgacaaagctgttaaagatgctcttagggaaactaacaggttactt
aacatgcacagaaatgttccagaaccaacaacagaaacttcaaataaaatcgaatgtcaa
aaagctccagttattgacctaagacaagtttgtgataatgtgattttaaatggagacagc
tctaccacccaagccgtatccaattctccagtgaggtcaaccatgcacgaagggtcattg
aagcgaaaatcagccaagcgttgcaaccggaaattcaaaaaaacaatcaccgctgagagt
ttacaagcagttagcatggcaagctatacaaggaaaatgggggttcccccaactcaggaa
caagcacaatcaactcaagttacaacttctacattaagttcattccagatcccccttagc
agtgttgccgaagctgccccgatgcgattatatgtgaaacaggagccggtatcaagcttg
tatcttaccactacccccacccaacctactgtatgcaatgtaatgtcagtgaataattcg
cataatatggtgattcccccttctatacccataaacctcacccatgttacccctaaaaat
gaagttgttttacctcaaagcttcgttgtcagatcagacactttacatactggtgcttct
tccccattggttaatatttcaaccaatggcattctagctcggccaaagatacttccactg
accaatcacaaccaaccaccaagtgatcagaaagaaggaaagcacagtcaaacaaagtca
gcaaccaaacccctaatgggttcaatcgggggtcccaagaaacccattgtacccgccgct
taccccagttttacccctactgtaatcggggtgaacccagtcatggggttggagcaaaga
aatgaacaactgactataaaagacttggatggtagagcaatgaaacgtcagcagcgaatg
ataaagaatcgtgaagctgcctgtcaatcaagacagagaaggaaagaatacgtgagcaca
ttagagcaacaaatgttggaatgtttggacgacaacaacaagcttcgatcaatgaatcaa
caactcagggataaagtgatggaacttgaaaatgagaacactcgtcttcgtagcttggct
ggtatgaccactagcggtcagcgaagagcagcttgtattcttatgctcgttctatttatc
gggttcaatattcacccactaagttttctcgctaaccagtcaatttctggtgaagacaca
ccaataaagttcacaccagaagatgctggcaactttaatgtagtcaaaaactggccagca
ccggttgaatccggttttcatggcaggcagctgctctctgttgaggagcaaggaggaaaa
agtgagagaggagtgggaggagttagagcagggagtgagactcaggtgtcatctagttta
aagaaggattctttctggatggatgatttggttaataattataagaaggaacacctggat
aagatccttgaggtcctccgagatacttcatccatctcactacagaggatgttgaggagg
aaactaaaggaggaacttgggatcagagtcccgatgccgataccgaggaccaggagaata
tcttatactcccaccaacacacatgaacagaggccaccagacatgaacagtattaaccaa
aaattaagattctatgctccaaagccacatccgagcattaaaccagcgccaaccaatgtg
aaaattaacttgtgtgaaagtttaaacaaaaatgagaaacaactgaatgagactgaatct
ataagggtcagcaaagacttggaccaatggattgccagagaaaaacataataaggaatca
aatcatatgaagaactatgtgaataagaaaccacctgatagaactaacaagagaagtagg
agaattgctgtgtctcctcaacaaagaaggccaaccaaagcaacaggcatagctctttac
aaagataaagaaaattctttcaacaagtttcttgatttattaaaccgacgcaatgacaca
atatatgtgatatctcttaaccaggatcacattctcctcccatccacggtgaagaattcc
tcgctccccactaagatgtcacttgttttccccactgctccacctaatgaaacttattca
aacaatgaggtttaccagacattgattcaaatcgattgtgaggtcacagctactgattat
ttacaagtcaaacgtgaattgttgccaaatagtcaaaaccatgttcctaatacagttcaa
cacactacagagccaaccaatagaaaaaggaaagcttaccacgcacctcatgctacaaat
gaattaaaagtccgtcgtaagagcaaaacgaatgaagaagctgatgcaacagtaacagat
gtagatttataa

DBGET integrated database retrieval system