KEGG   Chryseobacterium indologenes: CEQ15_03110Help
Entry
CEQ15_03110       CDS       T04932                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cio  Chryseobacterium indologenes
Pathway
cio00620  Pyruvate metabolism
cio00680  Methane metabolism
cio01100  Metabolic pathways
cio01120  Microbial metabolism in diverse environments
cio01200  Carbon metabolism
Module
cio_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEQ15_03110
  09102 Energy metabolism
   00680 Methane metabolism
    CEQ15_03110
Enzymes [BR:cio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CEQ15_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3837
Motif
Other DBs
NCBI-ProteinID: ASE60567
UniProt: A0A1Z3VZ51
LinkDB All DBs
Position
697472..700006
Genome map
AA seq 844 aa AA seqDB search
MIHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESRTGYDAGKTPEEI
VEEFFKNHTDLQSEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDNGTVTNLFE
RSYQDHKIEKVREKLKDFSVKVVFTAHPTQFYPSSVQRIIQDLRGAIAGDSVTQIDMLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRYVYYDTIGELFTKIKKTFGNGHFHLHEDIIQLG
FWPGGDRDGNPFVTADVTKRVAEELRSAILKSYYSHLKFIRRRLSFRGVSEVLTQLSEKL
YTAIFDGKNITSEDILKFTDEAEKILINEHNSLFLDLLINFRDRVKIFGTHFATLDIRQD
SRIHQQVINEVFAKVSGDENADAEQKFTRLIQTSGKVNADDFNDIVKDTLLTVSQVSEIQ
HLNGLRGMNRYIISNSDAVKDVMNVYAFFKICGYKDEEINMDIVPLFETMEGLANAENVM
KELYHHPVYKKHLERRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKEVLTKLSEQNNIKV
VFFDGRGGPPARGGGKTHDFYASQGKTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNAKKDLTEKERELIVELAEISYQKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGNGSELKFEDLRAIPFVGSWSQLKQNVPGFFGFGYAMQQLKEQGRFEEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKNNPKFGAFWNVLFDEYELSREIMLELTGF
KLLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatacacgaccaacgcgcagaaaaattcaggcagattgtggaaaataagttccagatc
tataattcattatttatgagcctgccttatgataaaatgacgaatatcgggatgctgctc
ccattcctgtatgaagaaagcagaaccggctatgatgcaggaaaaacacctgaagagatt
gtcgaagaattttttaaaaaccacaccgatcttcaaagtgaagagcagaagcttgaactt
ctttttaagatcatccagtatatcgaaagacaggttgttttattcgacagtattgaagac
gctgctttcccaaatcttcattcagaaagtgataatgggaccgttaccaacctttttgaa
cgttcttaccaggatcataaaattgaaaaggtacgtgaaaaattaaaggatttcagcgta
aaagtggtcttcactgctcaccctacgcaattttatcctagttcggtgcagagaatcatt
caggatttaaggggagctattgccggtgattctgtgacacagatcgatatgcttttgcag
cagctcgggaaaacaccttttgtgaataaagaaaaacccactccgatagatgaggcattg
agtatcatttcttatctgagatatgtgtattacgataccattggagaactgtttacgaaa
attaaaaaaactttcgggaacggacattttcatctgcatgaagatattatccagctgggt
ttctggcctggcggagatagagacggtaatccctttgtgacagctgatgttaccaaaaga
gtagcagaggaactgcgctcggctattttgaaatcctactacagtcatttgaaatttatc
cgaagaagattaagtttcagaggtgtttctgaagtgttgactcagttgagcgaaaagctg
tatactgccatttttgatggaaaaaatatcacttccgaagatattttaaagtttacggat
gaggcagaaaagatattgatcaacgagcataattctttgtttttagatcttttgataaat
ttcagagatcgggtgaagatcttcgggacacactttgccaccttggatatccgtcaggac
agcagaattcatcagcaggtcataaatgaggtttttgctaaagtatccggcgatgaaaat
gccgatgcagagcaaaaatttactcgattaattcagacctccgggaaagtgaatgctgac
gattttaatgatattgtaaaagataccttattaacggtttcacaggtttctgaaattcag
cacctgaacggattgagaggaatgaaccgatatattatttccaattcagatgcagtgaaa
gatgtgatgaacgtgtatgcatttttcaaaatctgtgggtataaagatgaagagatcaat
atggatattgttccgctttttgaaaccatggaaggactcgccaatgctgaaaatgtgatg
aaggagctttaccatcatcctgtatacaaaaagcatcttgagagaagaggaaatcaacag
accattatgctgggcttctcggatggaacaaaagacggaggatatctgaaagccaactgg
gagatttataaggcaaaagaagttctgacaaaactgtccgaacagaataatattaaagtt
gttttctttgacggtagaggaggtccgccggcaagaggaggagggaaaacccacgacttc
tacgcttcacagggaaaaacaattgccaataataaaatagaactgaccattcagggacaa
accattaccagtatttttggaaataaggaacaggcgaaatataattttgaacaattactt
actgccggtgtagaaaatgacgtatttaaaaacgctaaaaaagaccttacggaaaaagaa
cgcgaactgatagttgagcttgccgaaatcagttatcagaaatattctgaccttaaagcc
catccgatgtttgttccttatctacaggaaatgagtacccttgagtactacggaaaaacc
aatatcgggagccgtccatccaaaagaggaaacggcagtgagttgaagtttgaagacctg
agagcaattcctttcgtgggctcatggtcgcagctaaaacaaaatgtccccggtttcttt
ggtttcggatatgccatgcaacagctgaaagagcagggaaggtttgaagaagtaagagag
ctctacaaaggatcggatttctttaaaactttagttctgaattcgatgatgagtatgaat
aaatcctacttcccactgacttattatatcaaaaacaatccgaaattcggtgctttctgg
aatgtgctttttgatgaatatgagctttcaagagaaattatgctggaactgacaggcttt
aaattactgcaggaagaagatcctttgtcaagaaaatctgtgaagattcgcgagaaaatc
gtacttccgttattaagtattcagcaatatgcgcttatgaaaattcagaaaggagagggt
aacaaagaggcctatgaaaagctggtcaccagatccctgttcggaaatattaatgcgagt
agaaactcagcataa

DBGET integrated database retrieval system