KEGG   Chryseobacterium indologenes: CEQ15_08725Help
Entry
CEQ15_08725       CDS       T04932                                 

Definition
(GenBank) peptidase M12
Organism
cio  Chryseobacterium indologenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Astacin Peptidase_M10 Peptidase_M43 Reprolysin_5 Reprolysin_3
Motif
Other DBs
NCBI-ProteinID: ASE61569
UniProt: A0A4U8VJ83
LinkDB All DBs
Position
1905471..1906307
Genome map
AA seq 278 aa AA seqDB search
MELHKKILFGSFISLAMIACNTNENVEEKSAEAQNVSELQAVPKADIPAGFENTQMCKDV
YLPGEGYIPGTASKGAVVTSKKWPNGTVLTVLLSGGTTKVRNKVMQYAQQWSQYANITFK
FVTSGSAQIRVTFTSGAGSYSYIGKDALNIASNKETMNFGWFNDNTSDTEFSRTTIHEFG
HALGMIHEHQHPLAAIPWDKPKVYAYYAGYPNYWTQAQVDNNLFAKYSTSQTQYSAYDKL
SIMHYSISSDLTTNGFSVGNNTVLSATDKQFIASVYPK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaactacacaagaagatcctgtttggatcatttatttcacttgctatgatagcatgt
aatactaatgaaaatgtagaagaaaaatccgcggaggcacaaaatgtatcagagctgcaa
gcggtaccaaaagcagatatccccgcaggttttgaaaatacacaaatgtgtaaagatgtt
tatcttccgggagaaggttatattcccggaacggcctctaagggagcagtcgttaccagt
aaaaaatggcctaacggtactgttctgacagtacttctgtccggtggtactaccaaggta
cgcaataaagtaatgcaatatgcacaacaatggtcacagtatgctaacattacttttaaa
tttgtcaccagtggatcggcacagattcgtgtcacttttacatccggagcaggctcttat
tcatatatcggtaaggatgctcttaatattgcatccaataaggaaacgatgaactttggc
tggttcaacgacaatacaagtgatacagaattcagcagaacaacgatccatgaattcgga
catgctttgggtatgatccatgaacaccagcatcctttggcggctattccatgggataag
ccaaaagtatatgcctattatgcaggatatccgaattactggactcaggctcaggtagat
aataatctttttgcaaagtattccacttcacaaacacaatatagtgcttacgacaagttg
tcaattatgcactacagcattagctctgatcttactacaaacggattcagtgtaggaaac
aatacggttttatctgctaccgataagcagtttattgcatcggtatatccgaaataa

DBGET integrated database retrieval system