KEGG   Chryseobacterium indologenes: CEQ15_15850Help
Entry
CEQ15_15850       CDS       T04932                                 

Definition
(GenBank) 3'-phosphoesterase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cio  Chryseobacterium indologenes
Pathway
cio03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cio00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CEQ15_15850
Enzymes [BR:cio01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEQ15_15850
DNA repair and recombination proteins [BR:cio03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CEQ15_15850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: ASE62858
UniProt: A0A1Z3W533
LinkDB All DBs
Position
3521421..3522026
Genome map
AA seq 201 aa AA seqDB search
MALKDYQQKRKFDETSEPKGKTKKSKNKLIFVIQRHAASRLHYDFRLEMEGVLKSWAVPK
GPSLDPNDKRLAMMVEDHPYDYKDFEGNIPEGNYGAGQVEVWDSGTYEPLDENSKLSDEK
ELLKELHAGSLKFVLHGKKLKGEFALVKMKNSENNAWLLIKHKDEFAESPYDAEENTSPK
SLVTKFLEEKKSLKTSKKKKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaagattatcaacagaaacggaagttcgatgaaacttctgaacctaaagga
aaaacaaagaagagcaaaaataaactgatttttgtgattcaaaggcatgctgctagccga
cttcattatgatttcagattggaaatggaaggagtactgaaaagctgggcggttcccaaa
ggcccatcattagatccaaacgataaacgtcttgccatgatggtagaagatcatccttat
gattataaagattttgaaggaaatattcccgaaggaaactatggtgccggccaggtagaa
gtatgggatagcggaacttacgaacctttagatgaaaattctaaactctctgatgaaaaa
gagctgttgaaagaattgcatgcgggatctttaaagtttgttctccatggcaaaaagctc
aaaggtgaatttgctctggttaaaatgaaaaacagtgaaaataatgcctggctgcttatc
aaacataaggatgagtttgcagaaagtccgtatgatgcagaagaaaacacttcaccaaaa
tcattggtcacaaaatttctggaggaaaaaaaaagcctaaaaacaagcaaaaaaaagaag
ttgtag

DBGET integrated database retrieval system