KEGG   Chryseobacterium indologenes: CEQ15_20410Help
Entry
CEQ15_20410       CDS       T04932                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cio  Chryseobacterium indologenes
Pathway
cio00564  Glycerophospholipid metabolism
cio01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cio00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CEQ15_20410
Enzymes [BR:cio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CEQ15_20410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 HI0933_like NAD_binding_8 Thi4 FAD_binding_3 Pyr_redox_2 Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: ASE63676
UniProt: A0A1Z3W7E2
LinkDB All DBs
Position
complement(4547051..4548649)
Genome map
AA seq 532 aa AA seqDB search
MKRNEELSKLTNVKQWDFIVIGGGASGLGSALDAVSRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAKNAAHIVKNQSFIIPNYTWWGGIYYKIGLSVYD
FLAGKLSLGKTKYISKSKTIEKLPTIEQNHLMSGVVYQDGQFDDARLAINLTQTIIEKGG
SAINYMKVVGLLKNDSGKVIGVTAEDQFTQQQYQIHANVVINATGVFTNEILNMNNPKHG
KFVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLKDESFEP
RALEEEISFVLNTARQYLAKKPTREDVKSVFAGLRPLAAPKDGAKSTKEVSRSHKVITSD
TGLVSIIGGKWTTYRKMAEDTIDEAMKVHQLGNTPSKTEHLSIHGNMKPELVDRTNHLYV
YGSDIPAVKALQESNPRYAQKIHPNHPFTVAEVVWAVRNEMAVIIEDILARRVRLLFLDA
RAAIDCAHNVARIIAEENGNSEEWAQKQEDEFIALAKGYLLTPYSPKVINLN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacgaagaactcagtaaattaaccaatgtaaaacagtgggactttatagtc
ataggaggaggagccagtggtttaggttcagcattagacgcagtaagcagaggattcaaa
actttattgcttgaatcccacgactttgcgaaagcaacatccagcagaagtaccaaattg
gtacatggtggagtaagatatcttgcacagggagatatcggtttggtaaaagaagcatta
aaagaaagaggcttgttggctaaaaacgcagcacatattgtgaaaaaccaatcttttatc
attcctaattatacctggtggggcggaatctactacaaaataggattatcagtttatgat
ttcctagccggaaaactaagtttgggaaagacaaaatacatcagcaaatcaaaaaccatc
gaaaagctgccaactattgaacaaaaccatttgatgagtggagttgtttaccaggacgga
cagtttgatgatgccagattggcgatcaatttaacccagactattattgaaaaaggcgga
agtgcaatcaattatatgaaggtagtaggtctgttgaaaaatgattccggtaaagtaatc
ggagtgactgcagaagatcagtttacccaacaacagtatcagattcatgccaatgttgtc
atcaacgcgacaggagtattcaccaacgagattctcaacatgaataatccgaaacatggc
aaatttgttgtaccgagtcagggaatccacctggtattggataaatctttccttaaaagt
gatgatgccattatgattccaaaaacttccgatggcagagtattgtttgttgtaccatgg
catgacagagcactggtaggaactaccgacactcttttgaaggatgaaagttttgaaccc
cgtgccctggaagaagagatcagctttgttttaaatacagcaagacaatatttagcaaaa
aaacctacccgcgaggatgtgaaatcagtttttgcaggccttcgtccgcttgccgcccct
aaagacggtgccaaaagtacaaaagaagtttcccgcagccacaaagtgatcacttcagac
acaggactggtttctattatcggaggaaaatggacgacctaccgtaaaatggctgaagat
acaatagacgaagccatgaaagtgcatcagcttggaaacaccccttctaaaacagaacat
ctttccattcacgggaatatgaaaccggagctggtagacagaaccaatcatttatatgtt
tacggatctgatatcccggctgtaaaagctcttcaggaaagcaaccctcgttatgcgcaa
aaaatacacccaaatcaccctttcactgtggccgaggtagtatgggcggtaagaaacgaa
atggctgtgatcattgaagatattttagcaagaagagttcgtttgttattcttagatgca
agagcagcgatagactgtgctcacaatgtagcgcgcatcattgctgaagaaaatgggaat
tctgaagaatgggctcaaaaacaggaagacgaatttatagcactggcaaaaggatattta
ctgactccttattcccctaaagttattaacctaaattaa

DBGET integrated database retrieval system