KEGG   Citrobacter sp. CFNIH10: C2U53_05055Help
Entry
C2U53_05055       CDS       T05324                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00030  Pentose phosphate pathway
cir01100  Metabolic pathways
cir01110  Biosynthesis of secondary metabolites
cir01120  Microbial metabolism in diverse environments
cir01130  Biosynthesis of antibiotics
cir01200  Carbon metabolism
cir01230  Biosynthesis of amino acids
Module
cir_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cir_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C2U53_05055 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    C2U53_05055 (tkt)
Enzymes [BR:cir01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     C2U53_05055 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AUZ63270
UniProt: A0A3Q8D543
LinkDB All DBs
Position
complement(379271..381262)
Genome map
AA seq 663 aa AA seqDB search
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPSNPSWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELQNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLVA
FYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKRAVEEARAVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAG
QAKESAWNEKFAAYAKAFPQEAAEFTRRMKGEMPSDFDAKANEFIAKLQANPAKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
ISLHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVA
SLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQNLAQQERTEEQLANIARGG
YVLKDCAGQPELIFIATGSEVELAVAAWDKLTAEGVKARVVSMPSTDAFDKQDAAYRESV
LPKAVTARVAVEAGIADYWFKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVVAKAK
ALL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacgtaaagagcttgccaatgctattcgtgcgctgagcatggacgcagtacag
aaagccaaatccggtcatccgggtgccccgatgggtatggctgacattgccgaagtcctg
tggcgtgatttcctgaaccacaacccgagcaacccgtcctgggccgatcgtgaccgtttc
gtactgtctaacggccacggctccatgttgatttacagcctgctgcacctcaccggttac
gatctgccgatgtctgagctgcagaacttccgtcagctgcattccaaaactccgggccac
ccggaagtgggttacaccgccggtgtggaaaccactaccggtccgctgggtcagggtatt
gcgaacgcggtcggtatggctatcgctgaaaaaacactggctgcacagtttaaccgtccg
ggccatgacatcgttgaccactacacctatgcgttcatgggcgacggctgcatgatggaa
ggtatctctcacgaggtatgctctctggccggtacgctgaagctgggcaaactggttgcg
ttctacgatgacaacggtatctctatcgacggtcacgttgaaggctggttcactgacgac
accgctaaacgttttgaagcctatggctggcacgttgtgcgcggcgtagatggtcacgat
gctgacgcgatcaaacgtgcagtcgaagaagcacgtgccgtcactgacaaaccgtccctg
ctgatgtgcaaaaccatcatcggtttcggttccccgaacaaagcgggtacccacgactcc
cacggcgcgccgctgggcgacgcagaaatcgcactgacccgcgaacagttgggctggaaa
tacgcgccgttcgaaatcccgtctgaaatctacgctcagtgggatgcgaaagaagccggt
caggcgaaagagtctgcctggaacgagaaatttgccgcctacgcgaaagccttcccgcag
gaagcagctgagttcacccgtcgtatgaaaggtgaaatgccgtctgatttcgacgcaaaa
gcgaacgagtttattgctaagctgcaggctaatccggcgaaaatcgccagccgtaaagcg
tctcagaatgcgatcgaagcgtttggtccgttgctgccagaattcctcggcggctctgct
gacctggcgccgtctaacctgacgctgtggtcgggttctaaagcgatcaatgaagatgct
gccggtaactatatccattacggcgtacgcgaattcggtatgaccgcgattgccaacggt
atctccctgcacggtggtttcctgccgtacacctccaccttcctgatgttcgtggaatat
gcccgtaacgcggtacgcatggctgcgctgatgaaacagcgtcaggtgatggtttacacc
cacgactccatcggtctgggcgaagatggcccgactcaccagccggtagagcaggtggct
tctctgcgcgtcacgccgaacatgagcacctggcgtccatgtgaccaggttgaatccgcc
gtggcgtggaagtacggcgttgagcgtcaggacggcccgaccgcgctgatcctctcccgt
cagaacctggcacagcaggaacgtactgaagagcaactggcgaacatcgcgcgcggtggc
tacgtattgaaagattgtgcaggccagcctgagcttatcttcatcgcgaccggttctgaa
gttgagctggcggttgccgcatgggacaaactgaccgcagaaggcgtgaaagcgcgcgtg
gtctccatgccatctactgacgcgttcgacaagcaggatgctgcttaccgtgaatccgta
ctgccgaaagcggttaccgctcgcgtggcagtggaagccggtatcgctgactactggttc
aagtacgtgggtctgaacggcgcgatcgtcgggatgaccaccttcggtgaatctgctccg
gcagagctgctgttcgaagagttcggcttcaccgtcgacaacgttgtcgcgaaagcaaaa
gcactgctgtaa

DBGET integrated database retrieval system