KEGG   Citrobacter sp. CFNIH10: C2U53_07555Help
Entry
C2U53_07555       CDS       T05324                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cir01100  Metabolic pathways
cir01110  Biosynthesis of secondary metabolites
cir01130  Biosynthesis of antibiotics
cir01230  Biosynthesis of amino acids
Module
cir_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C2U53_07555
Enzymes [BR:cir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C2U53_07555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE APS_kinase ABC_tran AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_28 His_biosynth AAA_25 AAA_29 RsgA_GTPase PduV-EutP AAA_2 Mg_chelatase AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AUZ63703
UniProt: A0A3Q8DF07
LinkDB All DBs
Position
complement(851170..851691)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgacgtagaaggtgaagacggcttccgc
gatcgtgaagagaaagtcatcaacgaattgacggaaaaacagggtattgtgctggctacc
ggtggtggctctgtaaaatcgcgtgaaacccgtaatcgtctttccgcgcgtggcgtcgtg
gtctatctcgaaacgaccatcgaaaaacaacttgcgcgtacgcagcgcgataaaaaacgt
ccgctgttgcaggtagaagcgccgcctcgtgaagttctggaagcgttggccgacgaacgc
aatccgctgtatgaagagattgccgacgtaaccattcgtaccgatgatcagagcgccaaa
gtcgttgcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system