KEGG   Citrobacter sp. CFNIH10: C2U53_07590Help
Entry
C2U53_07590       CDS       T05324                                 

Definition
(GenBank) carboxypeptidase/penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00550  Peptidoglycan biosynthesis
cir01100  Metabolic pathways
cir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C2U53_07590
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C2U53_07590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cir01003]
    C2U53_07590
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
    C2U53_07590
Enzymes [BR:cir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     C2U53_07590
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C2U53_07590
Glycosyltransferases [BR:cir01003]
 Polysaccharide
  Bacterial polysaccharide
   C2U53_07590
Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   C2U53_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AUZ63709
UniProt: A0A3Q8D8E2
LinkDB All DBs
Position
855399..857975
Genome map
AA seq 858 aa AA seqDB search
MKLNGKSPVKFVKYLLILAVCCILLGAGSIYGLYRYIEPQLPDVATLKDVRLQIPMQVYS
ADGELIAQYGEKRRIPVTLNQIPPEMVKAFIATEDSRFYEHHGVDPVGIFRAASVALFSG
HASQGASTITQQLARNFFLSPERTLMRKIKEVFLAIRIEQLLSKDEILELYLNKIYLGYR
AYGVGAAAQVYFGKSVDQLDLGEIAVIAGLPKAPSTFNPLYSMDRATARRNVVLSRMLSE
GYITQAQYDQARNEPIDANYHAPEIAFSAPYLSEMVRQEMYNRYGENAYEDGYRIYTTIT
RKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGETAWDSKKITDTLKALPTYGPLLPA
VITSANPQEATATLADGTSVSLRMEGIRWARPYRSDTQQGPTPRKVTDAVQTGQQIWVRK
MGEAWWLAQVPDVNSALVSINPKNGAVLALVGGFDFNQSKFNRATQALRQVGSNIKPFLY
TAAMDKGLTLASMLNDVPISRWDAGAGSDWRPKNSPPQYAGPIRLRQGLGESKNVVMVRA
MRAMGVDYAAEYLQRFGFPAQNIVRTESLALGSASFTPLQVARGYAVMSNGGFLVDPYFI
SKIETDQNGVIFEAKPKIACPECDIPVIYGDTQKSNVLENSNVEDVSISGEQQNAAVPMP
KLEQANQALVAQTGAQEYAPHVINTPLAFLIKSALNTNIFGEPGWMGTGWRAGRDLNRHD
IGGKTGTTNSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKS
AQPAWDAYMKVVLEGVPEEPLTPPPGIITVNIDRSTGQLANGGNSRAEYFIEGTQPTQQA
VHEVGTTITDGGETHELF
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaatgggaaatctccggtgaagttcgtaaagtatttattgatccttgcagta
tgttgcatcctgctgggagcaggctcgatttatggcctctatcgctatattgagccacag
ttacctgacgtcgcgacgcttaaagatgtgcgtttgcagatcccgatgcaggtttacagc
gcagatggcgagctcattgcgcaatatggtgaaaaacgtcgtattccggtgacgctcaat
cagatcccgccggaaatggtcaaagcctttatcgccacagaagacagtcgtttctatgag
caccacggcgttgacccggtggggattttccgtgcggcaagcgtagcgctgttctccggt
cacgcctcgcaaggggcgagtaccatcacgcagcagctcgcaagaaatttcttcctcagt
cctgaacgcacgttgatgcgtaagattaaggaagtgttcctggcgatccgcattgagcaa
ttgctgagtaaagatgagatcctcgaactctatctgaacaagatctacctcggttaccgc
gcttatggcgtcggggcggcggcgcaggtctatttcggtaaatcagtcgaccagttggat
ctgggtgagatcgcggtaattgccggcctgccgaaagcgccttctacctttaacccgctt
tattcgatggaccgcgcgaccgcacgtcgtaacgtggtgctgtcgcgcatgctgagcgaa
gggtacatcactcaggcacagtacgatcaggcgcggaatgagccgatcgacgccaactat
catgcgccggaaatcgccttctccgccccgtacctgtcagaaatggtgcgtcaggagatg
tacaaccgttatggcgaaaacgcctatgaagacggttaccgcatttacaccacgatcacc
cgtaaggtgcagcaggccgcgcaacaggcggtacgtaataatgtgctggactatgacatg
cgccacggctatcgcggtccggccaacgtgctgtggaaagtgggtgaaaccgcatgggac
agtaagaaaatcaccgatacgctgaaagcgctgccaacttacgggccgttgctgccagcg
gtgatcaccagtgcaaacccgcaggaagcgacggcgactctggcagacggcacttcggtc
tcgctgcggatggaaggcattcgttgggcgcgtccttatcgttcggatactcagcaaggc
ccgacgccgcgtaaggtcactgacgcggtgcagaccggtcagcagatctgggtgcggaag
atgggcgaagcctggtggctggcgcaggttccggatgtgaactccgcgctggtctcaatc
aatccgaaaaacggcgccgtgctggcgctggtcggcggttttgactttaaccagagcaag
ttcaaccgtgccactcaggcgctgcgtcaggtcggttctaacattaagccgttcctctac
actgccgcgatggacaaaggtctgacgctggcgagtatgctgaacgacgtgccaatttct
cgctgggatgctggcgccggttccgactggcgtccgaaaaactcaccaccgcagtacgca
ggcccgattcgtttacgtcaggggctgggcgaatcgaaaaacgtggtaatggtacgcgcc
atgcgggccatgggcgtggactacgcggcggaatatctgcagcgtttcggcttcccggca
caaaacattgtgcgtaccgaatccctggcgctgggctccgcgtcatttaccccgctacag
gtggcgcgtggttatgccgtcatgtcgaacggcggcttcctggtcgatccctatttcatc
agcaagatcgaaacggaccagaacggcgtaattttcgaagcgaagccgaaaatcgcctgc
ccggagtgtgatattccggtgatttacggtgatacccagaaatccaacgttctggaaaac
agcaacgtcgaagatgtctccatctctggcgagcagcagaacgccgccgtgccaatgccc
aaactggagcaggcaaatcaggcgttagtggcgcagaccggggcgcaagagtacgcaccg
cacgtgatcaacacgccgctggctttcctgatcaagagcgcgctgaataccaacattttc
ggcgaacccggctggatgggtaccggctggcgtgcaggtcgtgatctgaatcgccacgat
atcggcggtaaaaccgggaccaccaacagctcgaaagacgcctggttctccggctacggt
ccaggggtagtcacctccgtatggattggatttgacgatcaccgccgtgacctggggcgc
accaccgcctctggcgcgatcaaagatcaaatctctggctacgaaggcggtgcgaaaagt
gcgcaacccgcgtgggatgcttacatgaaagtggtgctggaaggggttcctgaggagccg
ctgacgccgccaccaggcatcatcacggtcaatatcgatcgcagcaccggacaactggca
aacggcggtaacagtcgggcagaatatttcatcgaaggcacgcagccgacacagcaggcg
gtgcatgaggtgggaacgaccatcactgacggtggtgagacacacgaactgttctaa

DBGET integrated database retrieval system