KEGG   Citrobacter sp. CFNIH10: C2U53_07825Help
Entry
C2U53_07825       CDS       T05324                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00564  Glycerophospholipid metabolism
cir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2U53_07825
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2U53_07825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AUZ63747
LinkDB All DBs
Position
903677..905185
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
AGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKFTWQARGLVNATGPWVKEFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKDCVLPGGEIGGDREDYAARLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSVADLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRMTQWLAEYVAKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaagatcttgcgtgcgcc
acctcttccgccagttctaaactgattcacggtggcttgcgctacctggaacactacgaa
ttccgactggtgagcgaagcactggctgaacgcgaagtgctgctgaaaatggccccgcat
atcgccttcccaatgcgctttcgtttgccgcatcgcccgcacctgcgtccggcatggatg
atccgtattggtctgtttatgtacgatcatttaggtaaacgcaccagcttaccgggttct
gccggtttgcgttttggcgcagaatcggtgcttaaacccgaaatcgtgcgcggtttcgaa
tattctgactgttgggttgacgatgcgcgcctggtacttgccaatgcgcaaatggtggtg
cgtaaaggtggggaagtgttaacccgcacccgggcaacctcggcgcgtcgcgaaaacggt
ctgtggatcgtcgaagccgaagatatcgacacgggtaaaaaattcacctggcaggcgcgt
ggactggttaacgccactggcccatgggtgaaagaattttttgacgaagggatgcacctg
ccttcgccatacggcattcgcctgatcaaaggcagccacatcgtggtgccgcgcgtccat
acccagaagcaggcttacattctgcaaaacgaagataagcgtattgtgtttgttattccg
tggatggatgagttctccatcattggtaccaccgacgtcgagtacaaaggcgatccaaaa
gcggtgaaaatcgacgaaagcgaaatcaattacctgctgaaagtgtacaacgcgcacttt
aagaaacagcttggtcgtgatgatatcgtctggacctattccggtgtgcgcccgctgtgc
gacgacgagtcggattcaccacaggccatcacccgcgattacacgctggatattcatgat
gaaaatggcaaagcgccgctgctttctgtcttcggcggtaaactgaccacctaccgtaag
ctcgccgagcacgcgatggagaaactgtcgtcgtactatcagggcattggcccggcatgg
accaaagactgcgtgctgccaggcggtgaaatcggtggcgatcgcgaagactacgcggcg
agactgcgccgtcgttatccgttcctgaccgaatcgctggcgcgccattactcacgcacc
tacggaagcaacacagagtggatcctcggcgaagccacctctgtcgcggatttaggcgaa
gatttcggccatgagttctacgaagcagagctgaaatatctggtagaccacgaatgggtt
cgccgtgcagacgatgcgctgtggcgtcgtaccaaagaagggatgtggctcaacgccgaa
cagcagtctcgcatgacccagtggctggcagagtacgtcgcgaaacatcagctttcactg
gcatcgtaa

DBGET integrated database retrieval system