KEGG   Citrobacter sp. CFNIH10: C2U53_15285Help
Entry
C2U53_15285       CDS       T05324                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02011  iron(III) transport system permease protein
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C2U53_15285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cir02000]
    C2U53_15285
Transporters [BR:cir02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    C2U53_15285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AUZ67765
UniProt: A0A3Q8DFR0
LinkDB All DBs
Position
complement(2462062..2464140)
Genome map
AA seq 692 aa AA seqDB search
MSHTLALHPVKKRDAIFLWVLLGWLAFVLLPSWSLDYGLLESTSDEILEAYGWSRFNISW
LWYLLPSLLLVRPFHEARREQRSRHTLDAGWALLCMAFIVISATVEGRGLGYATIVLFVA
LGAIMTLALTRLEWLGGDRFVIGSLVTIVALIGIFIVWPSIAIFIPMFTNDAGEFAPLAF
MNVLSQAHIIQVILNSIALSIAVGIGCTFFGLVLAIYTTRIAQRSAIIGRIFSILPIVTP
PFVVGLGVTLMMGRSGYVTELMVDWFGLTNTNWLYGFTGIWLAQVLAFTPMAFMILDGAI
KTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLIVIVQSLADFSNPLVLGGNFD
VLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCVQYMWIGKRSYVTVSGKSYRGDVQ
PLPVTLVWSVVAILAIWIAFNALLYGSIFYGSFTVNWGVDYTLTLDNFIKLFGQGMSDGA
WPSLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFKGKKTIEFTTMLCFAVPGTVAGVSYI
LAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQIDKSLDEASLSLRAGSLRTIT
HILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYG
SILIVVMLAIIFIFDWLIGEARISRSKAKNQA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacacacttgcactccatcctgtgaaaaagcgggatgcgatattcctttgggtt
ttactcggctggctggcattcgttctgctgccgagctggagcctggattacggtctgctg
gagtccacgagcgatgaaatcctcgaggcctacggctggtcacggttcaatatcagttgg
ctctggtatctgctgccgagcctgctgctggtacgcccgttccacgaagccagacgcgaa
cagcgcagccgccacaccctcgatgcgggctgggcgctgttgtgtatggcgtttatcgtc
atcagcgccaccgttgaagggcgcggtttaggctacgccactatcgtgctgtttgtcgcg
ctgggggcgatcatgacgctggcgctgacccgcctcgaatggctgggcggcgaccggttt
gtgatcggttcgctggtcactatcgtggcgctcatcggcatctttatcgtctggccgagc
atcgccattttcatcccaatgttcaccaacgacgccggggagttcgcgccgctggcgttt
atgaatgtgctgtcgcaggcgcatatcattcaggtgatcctcaactctatcgccctgtcg
attgcggtaggtatcggctgtactttcttcggtctggtactggcgatttatactacccgc
atcgctcagcgaagcgccattattgggcgtatcttttcgattctgccgatcgtcacaccg
ccgtttgtggtggggcttggcgtcacgctgatgatgggccgttccggctatgtgaccgaa
ttaatggtcgactggttcgggttgacgaacaccaactggctgtacggatttaccggcatc
tggctggcacaggtgctggcgtttaccccaatggcgtttatgatcctcgacggcgcgatc
aaaaccattcacccgtcgctggaagaagcgtcatataccctgcgcgccagccgctggcag
acgtttaacggcgtgtttgtcccactgctgaaaccggcgctggcgaacgccttcctgatt
gtcatcgtgcagtcgctggccgacttcagtaacccgttggtgctcggcgggaacttcgac
gtgttggcaacgcaaatttacttctacatcaccggctcacagcttgattaccaggccgcc
agtacgctgggtgcgttcctgctgctgttctcgctgctggtgttctgtgtacagtacatg
tggattggcaagcgctcttacgtcaccgtttccgggaaatcgtaccgtggcgacgtccag
ccgctgccggtgacgctggtctggagcgtggtggctattctggcgatatggattgccttt
aacgccctgctctatggcagcattttctacggcagcttcaccgtgaactggggcgtggac
tacaccctgacgctggataacttcatcaaactgtttggtcaggggatgagcgacggcgca
tggccttccttgctcgacaccctgctctatgccggcattgccgcgccgatcaccgccgcc
ttcggtctgctgatcgcctggattgtagtacgccagcagttcaaaggcaaaaagaccatc
gagttcaccaccatgttgtgctttgccgtaccgggcaccgtggcgggcgtttcgtacatc
cttgcctttaacagcgctccggtatacctcaccggcacggcggcgattgtcattatctcg
atggtgatgcgtaacgtcccggtcggtattcgcgccgggatcgccggactcggccagatc
gataaatcactggacgaagcctcgctcagtctgcgtgccgggagcttacgcaccatcacg
cacattctgttgccgctgctgcgcccggccattctctcggcgctgatctacagcttcgtg
cgcgccatcaccaccgtcagcgcgattgtcttcctcgttacgccggacacccgcgtagca
acggcctacattctgaaccgcgtggaagacggcgagtacggcgtggcgattgcctacggg
tcgattctgatcgtggtcatgttggcgattattttcatctttgactggctgattggggaa
gcgcgtatttcccggtctaaagccaaaaaccaggcgtaa

DBGET integrated database retrieval system