KEGG   Citrobacter sp. CFNIH10: C2U53_15435Help
Entry
C2U53_15435       CDS       T05324                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00473  D-Alanine metabolism
cir00550  Peptidoglycan biosynthesis
cir01100  Metabolic pathways
cir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C2U53_15435
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C2U53_15435
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C2U53_15435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
    C2U53_15435
Enzymes [BR:cir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C2U53_15435
Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
 Precursor biosynthesis
  Amino acid ligase
   C2U53_15435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK NHase_alpha PTS_2-RNA GARS_A
Motif
Other DBs
NCBI-ProteinID: AUZ65108
LinkDB All DBs
Position
complement(2492270..2493364)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFEVVLLGIDKQGQWHVSDASNYLLN
ANDPAHIALRPSATSLAQVPGRHEQQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLTIAPFITLTRANRNTISFAEVEARLGL
PLFVKPANQGSSVGVSKVTSEAQYAQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIDPHINDKIREIAIQAYQALGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagacccgctttgaggtcgtgctg
ttaggcattgataagcaaggacaatggcacgtcagcgatgccagcaattatctgctcaat
gccaacgatcctgcgcatattgcgctgcgtccttctgcgaccagccttgcgcaggttccg
ggcagacacgagcaacagttgattgatgcgcaaaatggtcagccgctgccgaccgtagac
gtgattttcccgattgtgcacggcacgctgggtgaagatggctcactgcagggaatgctg
cgcgtggcgaatctgcccttcgtgggttccgacgtgttgggttcagccgcgtgtatggat
aaagacgtcaccaaacgcttgttgcgtgatgccggactgactatcgcgccgtttattacg
ctgacgcgagccaaccgcaacacgataagctttgccgaggtagaagcccgtcttggcctg
ccgctgttcgttaagcccgccaatcagggatcgtctgtcggcgttagcaaagtcaccagc
gaagcgcagtacgcgcaggcggtcgccctcgccttcgaattcgatcacaaagtggtggtg
gagcaagggatcaaggggcgcgagatcgagtgcgcagtgctgggcaacgatcatccgcag
gccagcacctgtggcgagatcgtgctcaacagtgatttctatgcctacgacaccaaatac
attgacgataacggcgcgaaagtggtggttcctgcggcgattgatccgcacatcaacgac
aaaatccgcgagatcgccattcaggcgtatcaggcgctgggctgcgctggcatggcacgc
gtcgatgtctttttaaccgccgacaatgaggtggtgatcaatgagatcaacaccctgcca
ggctttaccaacatcagcatgtatccgaaactctggcaggccagtggcttaggttacacc
gacttgatcacccgtttgatcgaactggcgctggaacgccatgctgcagataacgcgctg
aaaacgacgatgtaa

DBGET integrated database retrieval system