KEGG   Citrobacter sp. CFNIH10: C2U53_16595Help
Entry
C2U53_16595       CDS       T05324                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cir  Citrobacter sp. CFNIH10
Brite
KEGG Orthology (KO) [BR:cir00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U53_16595
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2U53_16595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AUZ65323
UniProt: A0A3Q8DC77
LinkDB All DBs
Position
2756186..2757751
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAGLSEKVTFKEDNSLSV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIREIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELSQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLVPAASEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GTKVVGLEYRDRVSGDVHNVELAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaggcttatcttgagaaactgacgaaacct
gttgagctgattgcgacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgctggactgtcagagaaagtcacctttaaagaagacaacagcctgtcggtg
cgcaaaccctctttcctgatcaccaatccgggttcaacgcaggggccgcgttttgcaggt
tctccgctgggacacgaatttacgtcgctggttctggcgctgttgtggaccggtggacac
ccgtcaaaagaagcgcagtctctgctcgagcagatccgcgagattgacggcgattttgaa
tttgaaacgtattactcactctcctgccataactgccctgacgtggtgcaggcactgaac
ctgatggcggtgctgaatccgcgtatcaagcatacggcgattgatggcggcacgttccag
aacgagatcactgagcgtaacgtgatgggcgtaccggctgtctacgttaacgggaaagag
tttggtcagggtcggatgacgctgacggaaatcgtggcgaaagtggatactggcgctgaa
aaacgcgccgcagaagagctgagccagcgtgatgcttatgatgttctgattgtcggttcc
ggccctgcgggggcagcagcagcggtttactccgcacgtaaagggattcgtaccggcctg
atgggtgagcgttttggcggccaggtactcgatactgtggatatcgaaaactacatctct
gtcccgaaaacggaagggcaaaagttggctggtgcactgaaggcgcacgtcgatgattat
gacgtggatgtcatcgacagccagagcgccagcaaactggtgccagcggccagcgaaggc
ggtctgcatcagattgaaaccgcttccggtgcggtactgaaagcgcgcagcattatcatt
gctaccggtgcgaaatggcgcaacatgaacgttccgggcgaagatcagtatcgtaccaaa
ggcgtcacctattgcccgcactgcgatggtccgctgtttaaaggcaagcgtgtggcggtg
atcggcggcggtaactccggcgtagaagcggcgattgatctcgcagggattgtggaacac
gtgaccctgctggaatttgccccggaaatgaaggcggaccaggtactgcaggacaaagtt
cgcagcctgaaaaacgtcgatattattctgaacgcgcagacgacagaagtgaaaggcgat
ggcacgaaagtggttggtctggaataccgcgaccgtgtgagcggcgacgttcacaacgtt
gaactggcggggatcttcgtccagattggcctgttgccaaacaccacctggctggaaggg
gcgattgaacgcaaccggatgggtgaaatcatcatcgacgcgaaatgcgaaaccagtgtg
aagggcgtatttgcggcgggcgactgcaccaccgtaccgtacaagcagattatcatcgcg
accggcgaaggggcgaaagcctccctgagcgcctttgattacctgattcgtacgaagacg
gcataa

DBGET integrated database retrieval system