KEGG   Citrobacter sp. CFNIH10: C2U53_17115Help
Entry
C2U53_17115       CDS       T05324                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00020  Citrate cycle (TCA cycle)
cir00190  Oxidative phosphorylation
cir00650  Butanoate metabolism
cir01100  Metabolic pathways
cir01110  Biosynthesis of secondary metabolites
cir01120  Microbial metabolism in diverse environments
cir01130  Biosynthesis of antibiotics
cir01200  Carbon metabolism
Module
cir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cir_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U53_17115
   00650 Butanoate metabolism
    C2U53_17115
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2U53_17115
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2U53_17115
    1.3.5.4  fumarate reductase (quinol)
     C2U53_17115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AUZ65411
UniProt: A0A3Q8DAR6
LinkDB All DBs
Position
2854044..2855810
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNADGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEQGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGELRDATEDEIDASLARLNRWNNNRDGEDPVVIRKALQECMQHNFSVFREGDAM
AKGLEELKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDENWLCHSLYLPETESMTRREVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccagtcagagaatttgatgctgtagttattggcgcaggcggcgcaggtatg
cgtgcggcgctgcaaatttcccaaagcggccagacctgtgcgctgctgtccaaagtgttc
ccaacccgttcccataccgtttccgcgcagggtggcatcaccgtcgcgctcggtaatacc
catgaagataactgggaatggcacatgtacgacaccgtgaaagggtcggactacatcggt
gaccaggacgctatcgaatatatgtgtaaaaccggtccggaagcgattctggaactggaa
catatggggctgccgttctcccgtctcgacgacggtcgtatctatcagcgtccgtttggc
ggccagtcgaaaaacttcggcggtgagcaggcggcacgcaccgcagcggcagctgaccgt
accggtcacgcactgctgcatacgctgtatcaacagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggttaaaaacgccgatggcgcagtggtcggttgt
accgcactgtgcatcgaaaccggtgaagtggtttacttcaaagcccgtgcaaccgtgctg
gccaccggcggcgcaggccgcatttatcagtccaccactaacgcgcacatcaacaccggc
gacggcgtggggatggcaatccgtgccggtgttccggttcaggatatggaaatgtggcag
ttccacccaaccgggattgccggtgcgggcgtgctggtaacagaaggctgccgcggtgag
ggcggttacctgctgaataaacacggtgagcgctttatggagcgttatgcgccgaatgcg
aaagacctggcgggccgtgacgtggtggcgcgttccatcatgattgaaatccgtgaaggt
cgcggctgcgatggtccttggggtccgcacgctaaactgaaacttgaccatctgggtaaa
gacgtcctcgaatcccgtctgccgggcattctggaattgtcccgtacgtttgcacacgtt
gacccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtaaccggtcaggcattgacggtgaacgagcagggtgaagacgtggtggtt
ccggggctgtttgcggtgggtgaaatcgcctgcgtatcggtacacggcgctaaccgtctg
ggcggtaactcgctgctggatctggtggtctttggtcgtgcggccggtctgcatctgcag
gaatctatcgctgagcagggtgaactgcgcgatgccacagaagacgaaatcgacgcgtcc
ctggcgcgtctgaaccgctggaacaataaccgtgatggtgaagatccggtggtgattcgc
aaagcgctgcaggaatgtatgcagcataacttctcggtcttccgggaaggcgatgcgatg
gcgaaagggcttgaagagctgaaagccatccgcgagcggttgaaaaatgcccgtctggac
gacacctccagcgaattcaacacccagcgcgtagagtgtctggagctggataacctgatg
gaaactgcctatgccaccgcagtatccgccaacttccgtaccgagagccgtggcgcgcat
agccgcttcgacttcccggagcgtgatgatgaaaactggctgtgccattccctgtatctg
ccagagacggaatccatgacccgacgtgaagtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacatactaa

DBGET integrated database retrieval system