KEGG   Citrobacter sp. CFNIH10: C2U53_17120Help
Entry
C2U53_17120       CDS       T05324                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00020  Citrate cycle (TCA cycle)
cir00190  Oxidative phosphorylation
cir00650  Butanoate metabolism
cir01100  Metabolic pathways
cir01110  Biosynthesis of secondary metabolites
cir01120  Microbial metabolism in diverse environments
cir01130  Biosynthesis of antibiotics
cir01200  Carbon metabolism
Module
cir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cir_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U53_17120 (sdhB)
   00650 Butanoate metabolism
    C2U53_17120 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2U53_17120 (sdhB)
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2U53_17120 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     C2U53_17120 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AUZ65412
UniProt: A0A3Q8DTH2
LinkDB All DBs
Position
2855826..2856542
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPRMQDYTLEGEEGRDMMLLDALMQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPVSALVQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGISDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgatgacgctccgcgcatg
caggattacaccctggaaggcgaagaagggcgtgacatgatgctgctggatgcgttgatg
cagctcaaagagaaagaccccagtctctctttccgccgctcctgccgtgaaggcgtgtgt
ggttcagatggtctgaacatgaacgggaagaacggtctggcctgcatcacgccggtatca
gcgctggttcagcccggtaagaaaattgttatccgtccgctgcctggtttgccggtgatc
cgcgatttggtagtagacatggggcaattctatgcacaatatgagaagattaagccttac
ttattgaataatgggcaaaatcctccggctcgtgagcatttacagatgccagagcagcgg
gaaaaactcgatgggctgtatgaatgcattctgtgcgcctgctgctcaacgtcttgccca
tccttctggtggaatccggataagtttatcggtccggcgggtctgttagcggcctatcgc
ttcctgatcgacagccgtgataccgagacggacagccgcctggaagggataagcgatgca
ttcagcgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtcctaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgctgttgcaacgcagtgcgtaa

DBGET integrated database retrieval system