KEGG   Citrobacter sp. CFNIH10: C2U53_18355Help
Entry
C2U53_18355       CDS       T05324                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00550  Peptidoglycan biosynthesis
cir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C2U53_18355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cir01002]
    C2U53_18355
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
    C2U53_18355
Enzymes [BR:cir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C2U53_18355
Peptidases and inhibitors [BR:cir01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   C2U53_18355
Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C2U53_18355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AUZ67787
UniProt: A0A3Q8DU42
LinkDB All DBs
Position
3080559..3081761
Genome map
AA seq 400 aa AA seqDB search
MTQYVSSLRNFAAGSALLFLFAPTVMAAEQTIEPPSVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKAGKIKLTDMVTIGKDAWATGNPALRGSSVMFLKPGDQVA
VSDLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSSLNVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGTKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASFTLTEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLIVMEAVEEGGFFGRMWDFVLMKFHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatacgtttcttcccttcgcaatttcgcagcgggttcagcccttctctttctc
tttgcgccgacagtgatggcggcggaacagaccattgaaccgccgagcgtcgatgcgcgc
gcgtggattttaatggattacgccagcggtaaggtgctggctgaaggcaatgccgatgag
aaactggatccggccagtctgacgaaaatcatgaccagctatgtggtggggcaggcactc
aaagcgggcaaaattaaactgaccgacatggtgacgataggcaaagacgcgtgggcgacc
ggtaacccggcgctgcgcggctcctcggtcatgttcctgaagcccggcgatcaggtggcg
gtttccgatctcaataaaggggtgattattcagtccggcaacgacgcctgtatcgcactg
gcagactatgtcgcagggagccaggagtcgtttatcggtctgatgaatggttatgcgaaa
aagcttgggttgacgaacaccaccttccagacggtacacggtttggatgcgccgggccag
ttcagcaccgcgcgtgatatggcgctgctgggtaaagcactgatccacgatgtgccggaa
gagtatgcgatccataaagaaaaagagttcacttttaacaagattcgccagcccaaccga
aaccgtctgctctggagctccagcctgaacgttgacggcatgaaaacaggcaccacggcc
ggggccggatacaatctggtcgcgtcggccacccagggcgacatgcgtctgatttcggtg
gtattaggcaccaaaactgaccgtatccgctttaatgaatcagaaaaactgttgacctgg
gggttccgcttctttgagaccgtaacgcctatcaaaccggatgccacctttgtgacccag
cgcgtctggtttggtgacaagagtgaggtgaatctgggggctggcgaagccggttctgtg
acgattccgcgcggtcaactgaaaaacctgaaagccagctttacgctgacggaaccgcag
ctcaccgcgccgctgaaaaagggccaggtggtcgggacgattgacttccagttgaacggc
aaatcgattgaacagcgtccgttgatcgtgatggaggcggtagaagagggcggcttcttt
ggccggatgtgggatttcgtactgatgaaatttcatcagtggttcggtagctggttctct
taa

DBGET integrated database retrieval system