KEGG   Citrobacter sp. CFNIH10: C2U53_20725Help
Entry
C2U53_20725       CDS       T05324                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00020  Citrate cycle (TCA cycle)
cir00480  Glutathione metabolism
cir01100  Metabolic pathways
cir01110  Biosynthesis of secondary metabolites
cir01120  Microbial metabolism in diverse environments
cir01130  Biosynthesis of antibiotics
cir01200  Carbon metabolism
cir01210  2-Oxocarboxylic acid metabolism
cir01230  Biosynthesis of amino acids
Module
cir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cir_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U53_20725
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2U53_20725
Enzymes [BR:cir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C2U53_20725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AUZ66054
LinkDB All DBs
Position
3512101..3513351
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSLTLVHKGNIMKFTEGA
FKDWGYQLARDEFGAELIDGGPWMKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttatcgaaggcgacggtatcggtgttgac
gtaacccctgccatgctgaaagtggtcgatgccgctgtcgagaaagcctataaaggcgag
cgtaaaatctcctggatggaaatttacaccggtgagaaatctacccaggtatacggccag
gacgtctggctgccagctgaaaccctggatctgattcgtgactaccgcgtggcgattaaa
ggcccgctgactaccccagtcggtggcggtattcgctctctgaacgttgcgctgcgtcag
gaacttgacctgtacgtctgcctgcgtcctgttcgttactatcagggcactccaagcccg
gttaaacatccggaactgaccgacatggttatcttccgtgaaaactcagaagacatttac
gccggtattgagtggaaagcggattctgcagatgcggaaaaagtgatcaaattcctgcgt
gaagagatgggcgtgaagaaaattcgcttccctgaacactgcggtatcggtatcaaacca
tgctccgaagaagggaccaaacgtctggttcgcgcggcgatcgaatatgcaatcactaac
gaccgtgactctctgaccctggtgcataaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggttaccagttagcgcgtgacgaattcggcgctgaactgatcgatggc
ggcccgtggatgaaaatcaagaatccaaataccggcaaagagatcgtggtcaaagatgtg
atcgctgatgcgttcctgcaacagatcctgctgcgcccggcggaatacgatgtgattgcc
tgtatgaacctgaacggtgactacatttctgacgccctggcagcacaggtaggcggtatt
ggtatcgcccctggcgctaacatcggtgacgagtgtgcgctgtttgaagcaacgcacggt
acggcgccgaaatatgccggccaggacaaagtgaacccgggctctatcatcctgtccgct
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgatcgccgcgaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagagtttggtgacgcgatcatcgcgaatatgtaa

DBGET integrated database retrieval system