KEGG   Citrobacter sp. CFNIH10: C2U53_25955Help
Entry
C2U53_25955       CDS       T05324                                 

Definition
(GenBank) decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00860  Porphyrin and chlorophyll metabolism
cir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2U53_25955
Enzymes [BR:cir01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     C2U53_25955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 PrmA GidB Methyltransf_25 Methyltransf_4 Methyltransf_12 Cons_hypoth95 PCMT Methyltransf_11 Met_10 CMAS Methyltransf_18 Methyltransf_2 Methyltransf_23 RrnaAD DOT1 UPF0020 Methyltransf_15 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: AUZ66993
UniProt: A0A3S7DDH6
LinkDB All DBs
Position
complement(4487428..4487997)
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALAKLELHRASHLIDIGAGTGSVSIEAALQFPSLHITA
IERNPAALRLLDENRQHFACANIDILPGEAPMMMTEKADAVFMGGSGGHLTELIDWSMRQ
LHAGGRLVMTFILQENLNTALAHLQQRGVQDVDCLQMQISSLTTLGAGHYFKPNNPVFVI
ACQKEERHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagcttttcctgcgtggtgagaaggtgccgatgaccaaagaagcggtacgt
gcgctcgctctcgcaaaacttgaactgcaccgggccagtcacctgattgatatcggggcc
ggaaccggcagtgtgtccatcgaagccgcgctacagtttccgtcgctacacattacggct
attgagcgcaatccggcggcgctgcgtttactcgacgaaaaccgtcagcatttcgcctgc
gcgaatatcgatattctgccgggtgaagcgccaatgatgatgaccgagaaagccgatgcc
gtctttatgggtggcagtgggggacatcttacagaactgatcgactggtctatgcgccag
ttgcacgctggcggacgcctggtgatgaccttcatcctacaggaaaacctcaacaccgcg
ctggcacatctgcaacagcgcggtgtgcaggacgtggactgcctgcaaatgcagatttcg
tcgctgaccacgctgggcgcgggtcactatttcaaaccgaacaatcccgtttttgtcatc
gcctgccagaaggaagaacgccatgtctga

DBGET integrated database retrieval system