KEGG   Citrobacter sp. CFNIH10: C2U53_26860Help
Entry
C2U53_26860       CDS       T05324                                 

Definition
(GenBank) bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
  KO
K13694  murein DD-endopeptidase / murein LD-carboxypeptidase [EC:3.4.-.- 3.4.17.13]
Organism
cir  Citrobacter sp. CFNIH10
Brite
KEGG Orthology (KO) [BR:cir00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cir01002]
    C2U53_26860
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
    C2U53_26860
Enzymes [BR:cir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     C2U53_26860
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     C2U53_26860
Peptidases and inhibitors [BR:cir01002]
 Cysteine peptidases
  Family C40
   C2U53_26860
Peptidoglycan biosynthesis and degradation proteins [BR:cir01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   C2U53_26860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 Peptidase_C92 DHQS LRAT CHAP Ly49 DUF1287
Motif
Other DBs
NCBI-ProteinID: AUZ67157
UniProt: A0A3S7DDU4
LinkDB All DBs
Position
4672633..4673202
Genome map
AA seq 189 aa AA seqDB search
MVKSQPILRYILRGIPAIAVAVLLSACSTTTNTAKNTHSETLGVNQEASSLQASQDEFES
MVRNLDVKSRIMDQYADWKGVRYRLGGNSKKGIDCSSFVQRTFREQFGLELPRSTYEQQE
TGKSVSRTNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYN
EARRVLSRS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatctcaaccgatcttgagatatatcttgcgcgggatccccgcgatagcagtc
gcggtactgctttctgcatgtagcactaccacaaacaccgcaaagaacacgcattctgag
acgcttggtgtgaatcaagaagcttcctcactgcaagcttctcaggatgaatttgagagt
atggtacgtaacctcgatgttaaatcgcggattatggatcagtacgctgactggaaaggc
gtgcgctatcgtctcggcggcaactccaaaaaaggtattgattgttccagctttgtacag
cgtacattccgtgaacagtttggtttagaactcccacgctccacctacgagcaacaggaa
accggtaaatccgtttcgcgcactaatctgcgtactggcgatctggttctgttccgcgca
ggttcgacgggccgtcatgttggtatttacattggcaacaaccagtttgttcatgcctct
accagcagcggtgtcatcatctccagcatgaacgagccatactggaagaagcgctataac
gaagcgcgtcgggttctgagccgcagttaa

DBGET integrated database retrieval system