KEGG   Citrobacter sp. CFNIH10: C2U53_29575Help
Entry
C2U53_29575       CDS       T05324                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00250  Alanine, aspartate and glutamate metabolism
cir00280  Valine, leucine and isoleucine degradation
cir00410  beta-Alanine metabolism
cir00640  Propanoate metabolism
cir00650  Butanoate metabolism
cir01100  Metabolic pathways
cir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cir00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C2U53_29575
   00650 Butanoate metabolism
    C2U53_29575
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2U53_29575
   00280 Valine, leucine and isoleucine degradation
    C2U53_29575
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2U53_29575
Enzymes [BR:cir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2U53_29575
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C2U53_29575
Amino acid related enzymes [BR:cir01007]
 Aminotransferase (transaminase)
  Class III
   C2U53_29575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AUZ67638
LinkDB All DBs
Position
5226522..5227805
Genome map
AA seq 427 aa AA seqDB search
MSTNNELMQRRAHAVPRGVGQIHPIFAARAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLQLCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALFPCALHGISD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDITTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGKTLRNGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIRQGLDIIAQC
FDEVKHG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaataacgaattaatgcagcgtcgcgctcatgccgtcccgcgtggcgtagga
caaattcatccgatctttgccgcgcgcgcggaaaactgccgggtctgggatgtggaaggc
cgtgaattcctggattttgctggcggcatcgcggtgctgaacaccggacacctgcacccg
cagatcgtctcggcagtcgaagcgcaactgaaaaaactgtcccacacctgcttccaggtg
ttggcctatgagccgtatctgcaactgtgcgaaatcatgaaccagaaagtgccgggcgac
ttcgccaagaagaccctgctggtcaccaccggttccgaagcggtagaaaacgcggtgaag
atcgcccgcgcggcaacgaaacggacggggacgatcgcctttagcggtgcataccacggt
cgcactcactacaccctgtcgctgaccgggaaagtgaacccgtactctgccggaatgggg
ctgatgccgggtcacgtctatcgcgcgctctttccgtgcgccctgcatggcattagcgat
gatgacgccatcgccagcattcaccgcatctttaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgaaccagtacagggcgaaggcggtttttacgccgcctctccggcc
tttatgcagcgcctgcgcgcgatttgcgacgaacacgggatcatgctgattgccgatgaa
gtacagagcggtgcggggcgtaccggtacgctgtttgcgatggagcagatgggcgtggca
ccggacatcaccaccttcgccaaatccattgccgggggcttcccgctggcgggtgtcacc
ggacgcgccgacgtcatggacgccatcccgccgggtggactgggcggcacctatgccggt
aacccgattgcctgcgccgccgcgctggcggtcctgaacattttcgagcaggaaaatctg
ctgcaaaaagccaacgaactcggcaaaaccctgcgcaacggtctgctggcgattgccgaa
acgcatcgtgaaatcggcgatgtccgtgggctgggggcgatgatcgccatcgaactgttt
gaagacggcgaccacaacaagccggatgcaaaactgacggcagagatcgtcgcgcgcgcc
cgcgataaaggtctgatcctgctctcctgtgggccgtactacaacgtgctgcgcatcctc
gttccgctcaccattgaagaggcgcaaatccgccaagggctggacattatcgcccagtgt
tttgatgaggtgaaacacggttaa

DBGET integrated database retrieval system