KEGG   Citrus sinensis (Valencia orange): 102577960Help
Entry
102577960         CDS       T02983                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00010  Glycolysis / Gluconeogenesis
cit00051  Fructose and mannose metabolism
cit00052  Galactose metabolism
cit00500  Starch and sucrose metabolism
cit00520  Amino sugar and nucleotide sugar metabolism
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
cit01200  Carbon metabolism
Module
cit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cit_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102577960
   00051 Fructose and mannose metabolism
    102577960
   00052 Galactose metabolism
    102577960
   00500 Starch and sucrose metabolism
    102577960
   00520 Amino sugar and nucleotide sugar metabolism
    102577960
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102577960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cit04131]
    102577960
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102577960
Membrane trafficking [BR:cit04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102577960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1731
Motif
Other DBs
NCBI-GeneID: 102577960
NCBI-ProteinID: NP_001275786
UniProt: Q9FVD3
LinkDB All DBs
Position
4
AA seq 498 aa AA seqDB search
MGKVTVAATVVCAAAVCAAAALVVRRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGR
VVKQEFEEVSIPPHLMTGSSHELFDYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPV
RQTSIASGDLIKWTKGFSIEDTVGEDVVGELTKAMERIGLDMRVAALVNDTIGTLAGGRY
HNKDAIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDE
ALDTESLNPGEQIFEKIISGMYLGEIVRRVLCRMAEEANFFGDTVPPKLKIPFILRTPHM
SAMHHDTSPDLRVVGKKLKDILEISNTSLKMRKLVVELCDIVATRGARLSAAGIVGILKK
LGRDTVRDGEKQKSVIALDGGLFEHYTKFSACMQSTVKELLGEEVSETVVIEHSNDGSGI
GAALLAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtgacggtagcggcgacggtggtgtgcgcggcggcggtgtgtgcggcggcg
gcgctggtggtgaggcgtaggatgaagagcacggggaggtgggccagggcggttgctata
ttgaaggagatggaggagaagtgtgggacccccatagggaagctgaggcaggtagctgat
gcgatgacggtggagatgcacgccggcctcgcgtcggagggcggcagcaagctcaagatg
ctcatcagctatgtcgataatctccccactggggatgagaagggattgttttatgcattg
gacctgggcggcacaaacttccgtgtcctgcgagtacagttgggtggaagagaaggccgt
gttgttaaacaagaatttgaggaagtttcaattcctccacatttgatgactgggagttcg
catgaattatttgactatattgctgcagcactcgcaaaatttgttgctactgaaggtgaa
ggatttcatgtttcaccaggtagacaaagagagttgggttttaccttctcatttcctgtt
aggcaaacatcaatagcatcaggggatcttataaagtggaccaagggcttctctattgag
gatacggttggagaagatgtagtcggagaattgactaaagccatggaaagaatcgggctt
gatatgcgtgtggcagctttggtgaatgacaccatcggaacattagctggtggtagatac
cacaacaaggatgccattgctgctgtaatcttgggcactggaactaatgcagcatatgta
gagcgagcacatgcaattcccaagtggcatggtcttctgcctaaatcaggggaaatggtt
atcaatatggaatggggtaatttccggtcatcgcaccttccactaacagaatatgatgaa
gcattggacactgagagtttgaaccccggtgaacagatttttgaaaaaatcatctctggc
atgtatttgggagaaattgtacgcagagtcttgtgcaggatggcagaggaagctaacttt
tttggtgatactgttcctccaaaattgaaaattccattcatattgaggactcctcacatg
tcggctatgcatcacgacacatctccagatttgagagtagttgggaagaaactaaaggat
atattagagatatccaatacctctttgaagatgagaaaacttgttgttgagctctgtgac
atagttgcaactcgaggtgcccgcctatctgctgcagggattgtaggcatcctcaagaaa
ttaggacgagacacagtaagagatggggaaaaacagaagtcagtaatagcattggatggc
ggtttgtttgagcactacacgaaatttagtgcctgcatgcagagcacggtcaaggagttg
ctgggagaggaagtttctgagaccgtcgtcattgagcattctaatgatggatcaggcatt
ggagccgcactccttgcagcttcgcactcccaataccttgaggttgaagagtcttga

DBGET integrated database retrieval system