KEGG   Citrus sinensis (Valencia orange): 102606611Help
Entry
102606611         CDS       T02983                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102606611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cit02000]
    102606611
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102606611
Transporters [BR:cit02000]
 Other Transporters
  Pores ion channels [TC:1]
   102606611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 102606611
NCBI-ProteinID: XP_006489728
LinkDB All DBs
Position
9
AA seq 227 aa AA seqDB search
MTTKVKLLGFWCSPFAFRVVWALKLKGVEFEYIEEDIFNKSTELLELNPVHKKVPVLVHD
KRVIVESFVILEYIDETWPQDPLLPQDPYEKAMARFWAKFGDEKLLESAYKAMWSKGEEK
QKAMKEAVESLEKIEEVLGGKNFMGGNSIGYLDLAIGWIGYWIPVWEEAGGSMRILDSQK
FPAIAEWSAKFLKHPVIKENLPPRDRTLAYCHKRAEEIYANFCASEN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaagtgaagcttttagggttttggtgtagtccttttgcgtttagggtggta
tgggcactgaagctaaagggggttgaatttgaatacattgaagaagatatctttaacaaa
agcaccgagcttcttgaattgaacccggttcataaaaaggttcctgtgctggttcatgac
aagagagtgatagttgagtcgtttgttattctggagtacatcgatgagacgtggccacaa
gatccgttgctgcctcaagatccttacgaaaaagccatggctcgattttgggctaaattt
ggagatgaaaagcttttggaatcagcatataaggcaatgtggagcaaaggagaggagaaa
caaaaggctatgaaagaagcagtagaatccttggaaaagatagaagaagtactcggagga
aagaacttcatgggaggaaatagcattggttatttggaccttgcaattggatggatcggt
tactggattcctgtttgggaagaagctggtggatccatgcgaattcttgactctcagaaa
ttcccagccattgctgaatggagcgccaagtttctgaaacaccctgtcatcaaagaaaac
ttgccacccagggacaggacgcttgcctattgtcacaagcgagcagaagaaatatatgct
aacttttgtgcatcggagaattga

DBGET integrated database retrieval system