KEGG   Citrus sinensis (Valencia orange): 102608383Help
Entry
102608383         CDS       T02983                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00052  Galactose metabolism
cit00500  Starch and sucrose metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102608383
   00500 Starch and sucrose metabolism
    102608383
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102608383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102608383
NCBI-ProteinID: XP_006468477
LinkDB All DBs
Position
2
AA seq 396 aa AA seqDB search
MKKPEKMKKPEKTAAASYHQHLSLLLLFLYCIFVAAEKDSVGYGYSVRSVAVDSSLKSLT
AGLGLIRSSSVYGPDIQSLNLFASFETKDRLRVRITDSKKQRWEIPQEIIPRQSYCTHCW
LPENRLNSPVNHQTGPGNHFLSDPTSDLVFTLHTTPFGFSVKRRSSGDILFDTSPETSHS
DTFLVFKDQYIQLSSALPIERSHLYGIGEHTKKSFKLTPNDTLTLWNADLASANVDVNLY
GSHPFYIDVRSPNGTTHGVLLLNSNGMDVVYTGDRISYKVTGGIIDLYFFAGPSPDSVIQ
QYTELIGRPAPMPYWSFGFHQCRYGYENVSDLKAVVAGYAKAGIPLEVMWTDIDYMDGYK
DFTLDPINFPVNSMQNFVNTLHQNGQRYVLILDPGM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccagaaaaaatgaagaaaccagaaaaaactgctgctgcttcttatcatcaa
catctttcattattacttttatttctctattgcatttttgtagctgcagagaaagattca
gttgggtatggctactctgttcgatcagtcgctgttgactcctcactgaagtcgttgact
gctggacttggcctcatcaggtcctcctctgtttacggacctgatattcagagcctcaat
ctttttgccagctttgagacaaaagaccgtttgagagttcgaataacagattccaaaaaa
caaagatgggaaatcccgcaggaaatcatcccccgccaatcctattgcactcactgctgg
ctgccggaaaacagactaaactcaccggtaaaccaccaaacagggccgggaaaccacttc
ctctccgaccccacctcagacttagtcttcaccctccacaccaccccatttggcttctcg
gtcaaacggcgatcctccggcgacattcttttcgacacatcacctgaaacctcacactct
gacactttcttggtgtttaaggatcaatacattcaactctcttcagcattaccaatagaa
aggtctcatctgtatggaattggagagcacacaaagaaatcattcaagttgactcccaat
gacactctaactttgtggaatgctgacttggcctcagcaaatgttgatgttaatctctat
ggctctcatcctttttatattgatgtgaggtcgcccaatgggacaacacatggtgttctg
cttcttaacagcaatggcatggatgtcgtttatactggtgacaggattagttacaaggtt
actggagggattattgatttgtatttttttgccggaccttcgccggattcagtcatacaa
caatatacagagttaattggtcggcctgcccctatgccatattggtcctttggatttcat
cagtgtcgatatggttacgaaaacgtgtccgatcttaaagctgtggttgctggctatgca
aaagctggcatccctcttgaagttatgtggacagatattgattacatggatggatataag
gatttcactctggatcccatcaactttccagtgaactcaatgcaaaattttgtaaataca
ctccatcaaaatggacagagatatgtgctcatcttggatcctggtatgtag

DBGET integrated database retrieval system