KEGG   Citrus sinensis (Valencia orange): 102608891Help
Entry
102608891         CDS       T02983                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase LECRK3
Organism
cit  Citrus sinensis (Valencia orange)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr B_lectin S_locus_glycop PAN_2 PIP49_C APH Pox_ser-thr_kin Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102608891
NCBI-ProteinID: XP_015381516
LinkDB All DBs
Position
Unknown
AA seq 673 aa AA seqDB search
MNDTGNFVLASSSSSKLWDSFSNPSDTLLPGQTMETKQGLFSRKSETNFSRGRFQFRLLK
DGNLVLNIANLPTGDAYDAYYISGTYDPANSSNSGYRVMFNESGYMYILRRNGGRFDLTT
ESVVPAADFYYRATLNFDGVFAQYFYPKNGNGNWSAVWSQPENICDNISGEFGSGACGFN
SICTLDGDRRPMCECPKGYSLLDENEKYGSCKADFELSCNGGGQGYNKELFDFHEVKNID
WPQSDYERFKPYNEVQCKNSCLSDCFCAAVIFEDDSCCFKKLPLSNGMTDSRITSKAFIK
YKNKGDDPPSVPRPPDPDDKKKRKMMNATGSVLLGSSVFVNFAMVCGVGLGFFFIYKKKW
IRNSPGDGTVETNLRCFSYKALEEATDNFKEEAGRGSFGIVYKGVIETTRTSTTAVAVKK
LDRVFQDGEKEFKNEVVVIGQTHHKNLVRLLGFCDEGQNRLLVYEFLNNGTLASFLFGNL
KPSWNLRTNIAFQIARGLLYLHEDCSSQIIHCDIKPQNILLNDRYNARISDFGLAKLLTL
NQSKTIKTAIRGTKGYVAPEWYRKSTITAKVDVYSFGVLLLEIISCRKSFDIEMGEEYAI
LTDWAFDCYRNGKLDDLVEGDMEAMNDIKCVEKLLMVSIWCIQEDPSLRPTMRLADFSCV
LRIYLQAHMAFSI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatacaggcaattttgtgcttgcaagcagcagctccagcaagttatgggacagc
ttcagcaatccttcagatacattgctgccaggccaaacgatggagactaagcaagggctt
ttttctcgaaaatcggagaccaatttctcgcgaggacggttccaattccgcttgcttaaa
gacggtaatcttgtcctcaatattgcaaatttgcctactggtgatgcctatgatgcttac
tacattagtggtacttatgatcctgcaaactcatcaaattctggttaccgagtgatgttc
aatgagtctggttacatgtacatattgagaagaaatggcgggaggtttgatctcacaaca
gaaagtgtagtcccagcagcagacttttactacagagcaactctcaattttgatggcgtt
ttcgcgcaatatttttatccaaagaatggtaatggaaactggtccgctgtctggtctcag
cctgaaaatatttgtgataatatttcaggagaattcggaagtggtgcttgtggatttaac
agtatttgcaccttagacggtgatcgaaggccaatgtgtgaatgcccaaaagggtattct
ttgcttgatgagaacgaaaagtacggaagctgcaaagcagattttgaattaagttgtaat
ggaggagggcagggttataacaaagaattgtttgactttcatgaggtcaaaaatatagat
tggcctcagtcagactacgagcgtttcaagccctataatgaagtgcagtgcaaaaactct
tgcttgagtgattgtttctgtgctgcggtcatttttgaagacgatagctgctgcttcaag
aagctgcctctctccaatggcatgacagatagccgtattacgagcaaagcttttataaaa
tataagaataaaggtgatgatcctccatcagtccctcgtcctccggatcctgacgacaag
aagaaaaggaagatgatgaatgccacaggatcagtactcttaggaagctccgtgtttgtg
aattttgcaatggtttgtggagttggtcttggttttttcttcatctataagaagaaatgg
ataagaaacagtccaggcgatggcaccgttgaaacaaatttgcgttgttttagctacaaa
gcgcttgaggaagctacagataacttcaaggaagaagccggcagaggatcttttggtatt
gtttacaaaggtgtaattgaaacaacaagaacaagtactactgcagttgcagtcaagaaa
ttggatagagtgtttcaagatggtgaaaaagaattcaagaatgaagtcgtcgtgattggc
cagactcatcacaagaatcttgttcggttgttagggttctgtgacgaaggacagaacagg
ttgttggtgtatgagttcttgaataatggaacattagcaagtttccttttcggaaacttg
aagcctagttggaacctgagaactaacattgcatttcagattgcaagagggcttctgtac
ctacatgaagattgcagctctcagatcatccattgtgatataaagcctcagaatatattg
cttaatgatcgctacaatgctcggatatcggactttggtttggcaaagcttttgacactg
aatcagagcaaaactattaagacagctataagaggaacaaaggggtatgttgctcctgaa
tggtataggaagtcaacaatcacagcaaaggttgatgtgtacagctttggcgttttgttg
ctggaaatcatttcttgtaggaaaagttttgatattgaaatgggtgaggagtatgcaatt
ttaacagattgggcttttgattgctacagaaatgggaaattggatgatttggttgaggga
gacatggaagccatgaatgatataaaatgtgtagagaagcttctgatggtttccatttgg
tgcattcaagaggatccatctcttagaccaacaatgaggttagctgacttttcttgtgta
ctcaggatctatttacaggctcatatggcattctccatttag

DBGET integrated database retrieval system