KEGG   Citrus sinensis (Valencia orange): 102609118Help
Entry
102609118         CDS       T02983                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00010  Glycolysis / Gluconeogenesis
cit00020  Citrate cycle (TCA cycle)
cit00620  Pyruvate metabolism
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
cit01200  Carbon metabolism
Module
cit_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102609118
   00020 Citrate cycle (TCA cycle)
    102609118
   00620 Pyruvate metabolism
    102609118
Enzymes [BR:cit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     102609118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF4813
Motif
Other DBs
NCBI-GeneID: 102609118
NCBI-ProteinID: XP_006484453
LinkDB All DBs
Position
7
AA seq 479 aa AA seqDB search
MATLSPFLSKTPLSNTPTISFSSSISTPLKWKSITSFSPSGSSSSRSRRRIFIVQSKIRE
IFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEG
ESAPVGAAIGILAETEAEVAQAKAKAASAGAAAPASHPVTSTPVPAVSPPEPKKVAESAP
SGPRKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIAPSKSVAPSAAPAA
LPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIESLSVPTFRVGYPIITDALDALYEK
VKPKGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTNNANINIAVAVAINGGLITPVLQ
DADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAI
MAVGASKPTVVADADGFFGVKSKMLVNVTADHRIIYGADLATFLQTFSKIVENPESLTL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctactctttccccattcctctcaaaaactcccctttcaaacacccccaccatttcc
ttctcttcttccatttccactcccctcaaatggaaatctatcacttcattctcaccgtcc
ggatcttcttcttcccgctctcgccgtcgaatcttcatcgtccaatccaaaatccgcgag
atcttcatgcccgccctcagttcgactatgaccgagggcaagatcgtctcgtggatcaag
tcagaaggcgacgttctttccaagggagaaagcgtcgtcgttgtggagtccgataaggct
gacatggatgtcgagaccttttatgacggcattctcgccgcaattgtcgtccccgaaggc
gagtccgctcccgttggtgccgctatcgggattcttgctgagactgaggcggaagttgct
caagccaaggccaaagctgcgtccgcaggggctgcagctcctgcttctcatcctgttaca
tccactcccgttccagctgtttccccacccgagccgaagaaagtggcggagtctgctccc
agtgggcccaggaagactgtggcgacgccttacgccaagaagttattgaagcagcacaaa
gtggacattaattcggtggttggaacggggccgtttggtagaattactcctgaagatgtg
gagaaggcggctggaattgctccttccaagagtgtggcaccctctgcggctccggctgct
ttgccaaaacctgcgccggcggcagcaccagcagctcctctacttcccggttctactgtg
gtgccttttacgacaatgcaggctgccgtttcaaagaatatgatcgagagtctttcggtt
cccactttccgtgttggatatccaattataactgatgctcttgatgcgctttatgagaag
gtgaagccaaagggtgtgacaatgactgcgctgttagcaaaagctgcagcaatggcgctt
gttcagcatccagttgttaatgccagctgtaaagatggcaagagttttactaacaatgct
aacatcaacattgcggtggccgtggctatcaatggtggcttgataacacctgttcttcag
gatgcagataagttggatctgtatttgttatctcaaaaatggaaagagcttgtggagaaa
gctcgatcgaagcaacttcagccccatgagtacaattcaggtactttcactctatccaac
ctgggtatgtttggagtggacagatttgatgctattcttcctccaggccagggggctatc
atggctgttggagcatcaaagccgactgtagttgctgatgcagatggtttcttcggtgtg
aaaagtaaaatgctggtgaatgtaaccgctgatcaccgaattatttatggtgctgacttg
gctacattcctacaaacattttcaaagattgttgagaatccagaaagcttgacattgtag

DBGET integrated database retrieval system