KEGG   Citrus sinensis (Valencia orange): 102611084Help
Entry
102611084         CDS       T02983                                 

Definition
(RefSeq) glutamate decarboxylase 5-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00250  Alanine, aspartate and glutamate metabolism
cit00410  beta-Alanine metabolism
cit00430  Taurine and hypotaurine metabolism
cit00650  Butanoate metabolism
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Module
cit_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102611084
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102611084
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102611084
   00430 Taurine and hypotaurine metabolism
    102611084
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102611084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 102611084
NCBI-ProteinID: XP_006478102
LinkDB All DBs
Position
5
AA seq 498 aa AA seqDB search
MVISTTETDSREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNL
ASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVG
VGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDEL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCMGNARALREGLEK
TGRFEILSKDVGVPLVAFSLKDSSAHTVFEISEGLRKFGWIVPAYTMPANAENVAVLRVV
VREDFSRSLVERLISHIEEVLKEIDSLPSRVSTKTAHVTPMVNETQGDKPLKKSVRETQE
EVTRHWKRFMKGRRAGAC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgatttcaacaacagaaacagactccagggagattttgaactccacatttgcttca
agatatgtccgtgctgctattcccagattcaagatgccagataattcaatgccaaaggag
gcagcctatcaggtaataaatgatgagctgatgttagatggaaatccaaggctgaacttg
gcatcttttgtgaccacttggatggagcccgagtgtgataagcttgtcatggcttcgatt
aataaaaactatgttgacatggatgaataccctgtaaccacagagctccagaatcggtgt
gtgaatatgattgcccacctatttaatactccagttgcggatgacaagactgcagtgggc
gtggggactgtaggttcatcagaggcaataatgcttgctggcttggcttttaaaaggaag
tggcagcagaagagaaaagagcaaggcaaaccctatgataagcccaatatagtcactgga
gctaatgtgcaggtatgctgggagaaatttgcgaggtactttgaggttgagctgaaggag
gtgaaactggaagagggatattatgtgatgaatcctgtgaaagctgttgagttggtagat
gagaacaccatttgtgttgcagccattctgggatcaaccttgacgggagaatttgaggat
gttaagcttcttcatgacctcctcaccaaaaagaatgaggagaccggttgggacaccccc
attcatgttgatgctgctagcggcggatttattgctccttttctctatccagaccttgaa
tgggatttccgtttgccactggtgaagagcattaatgtcagtggtcacaagtacggcctt
gtatatgcaggtgttggctgggttgtctggaggaccaaagatgacttgccggatgaactt
gtctttcacatcaactaccttggatctgatcaaccgactttcaccctcaacttctcaaaa
ggctccagtcaaataattgctcaatattatcagtttatacggcttggctttgagggttac
aagaacattatggaaaattgcatggggaatgctagagcgctaagagaaggattagagaaa
acagggcgctttgaaattctctccaaggatgttggcgtacccttagtagccttttctttg
aaggacagcagcgcacacaccgtgtttgagatatccgagggtttgagaaagtttgggtgg
atagttccggcctatacaatgcctgctaatgctgaaaatgtggcggttcttcgggtggtt
gtcagggaggatttcagccgtagcttggtggaaagactcatctcacacatcgaggaagtt
ttgaaggaaattgactcgcttccaagtcgtgtatccacgaaaactgcccatgtcacaccc
atggtcaacgaaactcagggtgataaaccacttaagaagagtgtgagagagactcaggag
gaagtcaccaggcactggaagaggttcatgaaaggccggagagctggagcatgctga

DBGET integrated database retrieval system